KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3315Help
Entry
STM3315           CDS       T00065                                 

Gene name
yrbH
Definition
(RefSeq) D-arabinose 5-phosphate isomerase
  KO
K06041  arabinose-5-phosphate isomerase [EC:5.3.1.13]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00540  Lipopolysaccharide biosynthesis
stm01100  Metabolic pathways
Module
stm_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    STM3315 (yrbH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:stm01005]
    STM3315 (yrbH)
Enzymes [BR:stm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.13  arabinose-5-phosphate isomerase
     STM3315 (yrbH)
Lipopolysaccharide biosynthesis proteins [BR:stm01005]
 Unusual sugar
  STM3315 (yrbH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS CBS SIS_2 DUF2529
Motif
Other DBs
NCBI-GeneID: 1254838
NCBI-ProteinID: NP_462225
UniProt: Q8ZLS1
Position
3480969..3481955
Genome map
AA seq 328 aa AA seqDB search
MSHLALQPGFDFQQAGKEVLEIEREGLAELDQYINQHFTLACEKMFNCTGKVVVMGMGKS
GHIGRKMAATFASTGTSSFFVHPGEAAHGDLGMVTPQDVVIAISNSGESSEIAALIPVLK
RLHVPLICITGRPESSMARAADVHLCVKVPKEACPLGLAPTSSTTATLVMGDALAVALLK
ARGFTAEDFALSHPGGALGRKLLLRVSDIMHTGDEIPHVNKHATLRDALLEITRKNLGMT
VICDESMKIDGIFTDGDLRRVFDMGGDMRQLGIAEVMTPGGIRVRPGILAVDALNLMQSR
HITSVLVADGDQLLGVLHMHDLLRAGVV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatttagcgttgcaaccggggtttgactttcagcaggcaggcaaagaggtcctg
gaaattgaacgtgaaggcctggcggagcttgatcaatatatcaaccagcatttcacgctg
gcctgtgaaaaaatgttcaactgcaccggaaaagtggtggtcatggggatggggaaatcc
ggccatatcggacggaaaatggccgccacgttcgccagtaccggcacctcttcctttttt
gtacatccgggcgaagccgcgcacggcgatttggggatggttacgccgcaggatgtggtt
atcgctatctccaactccggcgaatccagcgagatcgcggcgctaataccggtacttaaa
cgtctgcacgtgccgttaatttgcattaccgggcgaccggaaagcagcatggcgcgtgcg
gcagatgtgcatctgtgtgttaaagtgcccaaagaagcgtgtccgttaggactggcgcct
accagtagtaccaccgcaacgctggtgatgggcgacgcgctcgctgtggcgttgttaaaa
gcgcgcggctttaccgccgaggatttcgctctgtcgcatcctggcggcgcgctgggacgt
aagctactgctgcgcgtaagcgatattatgcatactggcgatgagatcccgcatgttaat
aaacatgccaccctgcgtgatgcgctattagaaattacgcgtaaaaatctcggtatgacc
gtcatttgcgatgaatccatgaagatcgacggtatcttcaccgacggcgatttacgtcgc
gtattcgatatgggcggcgatatgcgccagttggggatcgccgaggtgatgacgccaggg
ggcattcgcgtgcgtcccggtattctcgctgtcgatgcgctgaatttaatgcagtcccgc
catatcacctccgtactggttgctgatggcgaccagttactcggtgtgttacatatgcat
gatctcctgcgtgcaggcgtcgtgtag

DBGET integrated database retrieval system