KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3472
Entry
STM3472           CDS       T00065                                 

Gene name
ppiA
Definition
(RefSeq) peptidylprolyl isomerase A
  KO
K03767  peptidyl-prolyl cis-trans isomerase A (cyclophilin A) [EC:5.2.1.8]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:stm00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    STM3472 (ppiA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:stm03110]
    STM3472 (ppiA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stm04147]
    STM3472 (ppiA)
Enzymes [BR:stm01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     STM3472 (ppiA)
Chaperones and folding catalysts [BR:stm03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    STM3472 (ppiA)
Exosome [BR:stm04147]
 Exosomal proteins
  Proteins found in most exosomes
   STM3472 (ppiA)
SSDB
Motif
Pfam: Pro_isomerase
Other DBs
NCBI-GeneID: 1254995
NCBI-ProteinID: NP_462375
UniProt: P20753
Position
complement(3621230..3621802)
AA seq 190 aa
MLKSTLAAVAAVFALSALSPAALAAKGDPHVLLTTSAGNIELELNSQKAPVSVKNFVDYV
NSGFYNNTTFHRVIPGFMIQGGGFNEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADK
DSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPTKP
VVILSAKVLP
NT seq 573 nt   +upstreamnt  +downstreamnt
atgctcaaatcgactctggcggctgtcgcagctgttttcgctctttctgctctttctccc
gcagcgttggcagcaaaaggcgatcctcatgtgctgttaaccacctccgccgggaatatt
gagctggagctgaacagccagaaagcgccggtttctgtgaaaaactttgtcgattacgtc
aacagtggtttctataacaacactacgtttcaccgcgttattcctggctttatgattcag
ggtggtggttttaacgagcagatgcagcagaagaaaccgaatccgcctattaagaatgaa
gccgacaacggtctgcgtaatactcgcggcacgatcgcgatggcgcgcaccgcagataaa
gacagcgccaccagccagttctttattaacgtcgcggataacgcttttctcgaccacggc
cagcgcgactttggctatgcggtatttggtaaagtggtaaaaggtatggatgtcgccgat
aaaatctcacaggtaccgacgcacgatgtcgggccttatcagaatgtgccgacaaaacca
gtcgttatcctttccgcgaaagtcctgccataa

DBGET integrated database retrieval system