KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3482Help
Entry
STM3482           CDS       T00065                                 

Gene name
gph
Definition
(RefSeq) phosphoglycolate phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00630  Glyoxylate and dicarboxylate metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    STM3482 (gph)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     STM3482 (gph)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_3 Hydrolase_6 S6PP
Motif
Other DBs
NCBI-GeneID: 1255005
NCBI-ProteinID: NP_462385
UniProt: Q8ZLK5
Position
complement(3637252..3638010)
Genome map
AA seq 252 aa AA seqDB search
MDKLQNIRGVAFDLDGTLVDSAPGLAAAVDMALYALELPVAGEERVITWIGNGADVLMER
ALTWAREERATLRKTMGKPPVDEDIPAEEQVRILRKLFDRYYGEVAEEGTVLFPHVADTL
GALHASGLSLGLVTNKPTPFVAPLLESLDIAKYFSVVIGGDDVQNKKPHPEPLLLVASRL
GMMPEQMLFVGDSRNDIQAAKAAGCPSVGLTYGYNYGEAIALSEPDVIYDSFNDLLPALG
LPHSDNQEIKND
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggataagttgcagaatattcggggcgtcgcctttgatcttgacggcacgctggtggat
agcgcgccgggtcttgccgcggcggtggatatggcgctgtatgcgctggaactgccggtc
gcgggcgaggagcgcgtgattacctggattggtaacggcgcagacgtattgatggaacgc
gcgctgacctgggctcgcgaggagcgcgccacgctgcgtaagacgatgggtaaaccgccc
gttgatgaagatattcctgccgaggaacaggtacgtattctgcgtaagctgttcgacagg
tattatggcgaagtggcggaagagggcaccgttttatttccccatgtcgccgacacgctg
ggcgcgctgcacgccagcggattgtcattaggtctggtgacgaataagccgacgccgttc
gtcgcgccgttgctggaatcgcttgatatcgccaaatactttagtgtggttatcggcggc
gatgatgtgcaaaataagaagccgcatccggagccgctgttgctggtggcaagccggctg
ggcatgatgccggagcagatgctttttgtcggcgattcgcgtaatgatattcaggctgca
aaagcggcgggctgcccttcggttggcctgacatacggctacaattatggcgaagcgatc
gctcttagcgagccggacgtcatttatgacagttttaacgatcttttgcccgcacttggg
cttccgcatagcgataaccaggaaataaaaaatgactaa

DBGET integrated database retrieval system