KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3646Help
Entry
STM3646           CDS       T00065                                 

Gene name
yiaE
Definition
(RefSeq) bifunctional glyoxylate/hydroxypyruvate reductase B
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00030  Pentose phosphate pathway
stm00260  Glycine, serine and threonine metabolism
stm00620  Pyruvate metabolism
stm00630  Glyoxylate and dicarboxylate metabolism
stm01100  Metabolic pathways
stm01110  Biosynthesis of secondary metabolites
stm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STM3646 (yiaE)
   00620 Pyruvate metabolism
    STM3646 (yiaE)
   00630 Glyoxylate and dicarboxylate metabolism
    STM3646 (yiaE)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STM3646 (yiaE)
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     STM3646 (yiaE)
    1.1.1.81  hydroxypyruvate reductase
     STM3646 (yiaE)
    1.1.1.215  gluconate 2-dehydrogenase
     STM3646 (yiaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 1255170
NCBI-ProteinID: NP_462547
UniProt: Q8ZLA1
Position
3833699..3834673
Genome map
AA seq 324 aa AA seqDB search
MKPSIILYKTLPDDLLHRLEAHFTVTQVPNLHPETVAQHAQAFASAQGLLGASETVNRAL
LEKMPALRAASTISVGYDNVEVDALTARKIVLMHTPAVLTETVADTVMALMLATARRVVD
VAERVKAGEWTESIGPAWFGVDVHHKTLGIVGMGRIGMALAQRAHFGFTMPVLYHARRRH
QEAEDRFNARYCDLDTLLQEADFVCVILPLTAETRHLFGATQFARMKSSAIFINAGRGPV
VDENALIAALQNGEIYAAGLDVFEQEPLSVDSPLLNMSNVVAVPHIGSATHETRYNMMAC
AVDNLIDALQGKIEKNCVNPQAAG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtccatcattctctacaaaaccctgcctgatgatttgctgcatcgcctggag
gcgcattttaccgtcacccaggtaccgaacctgcatccggaaacggtagcgcaacacgcg
caggcatttgccagcgcgcaaggccttctgggcgccagcgaaaccgttaaccgcgcgctg
ctggaaaaaatgccggcgctacgcgcggcgtcaaccatctcggtgggatacgataatgtc
gaggtggacgcccttactgcccgcaaaatagtcctgatgcacacgcctgccgttttgacg
gaaaccgttgccgatacggtgatggcattgatgctggccactgcccgccgcgtggtggac
gtcgcagaacgggttaaggcgggtgaatggacagaaagcattggcccggcgtggtttggc
gtcgatgtccatcacaaaacgctcggtatcgttgggatggggcgtatcgggatggcgctg
gcgcagcgagcgcactttgggtttaccatgccggttctctatcacgcccgtcggcggcat
caggaggcggaagaccggtttaacgcccgctactgcgatctggatacgttgttgcaggag
gctgattttgtctgcgtgatcctgccgctaacggcagaaacgcgacatctgtttggcgca
acacagtttgccagaatgaaatcgtccgccatttttattaatgccggacgcggcccggtg
gtcgatgaaaacgcgctgattgccgcgctgcaaaacggtgaaatatatgcggcaggtcta
gatgtctttgaacaggaaccgctatctgtggattcgcccctgctgaacatgtctaatgtc
gtcgcggtgccgcatattggctcggcaacgcatgagacgcgctacaacatgatggcctgt
gcggtggataatttgattgatgcgctgcagggaaaaatagagaagaactgcgtcaatccg
caagcggcgggataa

DBGET integrated database retrieval system