KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3757Help
Entry
STM3757           CDS       T00065                                 

Gene name
misL
Definition
(RefSeq) autotransporter outer membrane beta-barrel domain-containing protein
  KO
K12678  autotransporter family porin
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stm02000]
    STM3757 (misL)
   02044 Secretion system [BR:stm02044]
    STM3757 (misL)
Transporters [BR:stm02000]
 Other transporters
  Pores ion channels [TC:1]
   STM3757 (misL)
Secretion system [BR:stm02044]
 Type V secretion system
  Autotransporter-1 (AT-1) family
   STM3757 (misL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Autotransporter Pertactin
Motif
Other DBs
NCBI-GeneID: 1255281
NCBI-ProteinID: NP_462656
UniProt: H9L455
Position
3954773..3957640
Genome map
AA seq 955 aa AA seqDB search
MPTPQNYSFIAIAVSAALASMVFPSQAAWVDVDSLPSSGLVSQLPPELQAIIPAQASTGF
TKVGTMPNYVYQWNTGTIPVYGNGLTLNGPGAEAFEHTVTVIQNSGTGSPGVIFGNDLTI
RTQSANAANNGRDVDGIRTHGANTPDNPVFIITGDRTRIYVDGQDGDGINAGYNSLGQGW
TGSANIYVGDDLYIKTTGSQGRGITANAMRDASRAKNTIVVGNRAHIVTTGDSSEGLRTG
QSGSLIRLGDDATIETSGASSTGIYAASSSRTELGNNATITVNGASAHAVYATNATVNLG
ENATISVNSASKAASYSKAPAGLYALSRGAINLAGGAAITMAGDNSSESYAISTETGGIV
DGSSGGRFVIDGDIRAAGATAASGTLPQQNSTIKLNMTDNSRWDGASYITSATAGTGVIS
VQMSDATWNMTSSSTLTDLTLNSGATINFSHEDGEPWQTLTINEDYVGNGGKLVFNTVLN
DDDSETDRLQVLGNTSGNTFVAVNNIGGAGAQTIEGIEIVNVAGNSNGTFEKASRIVAGA
YDYNVVQKGKNWYLTSYIEPDEPIIPDPVDPVIPDPVVPDPVDPDPVDPVIPDPVIPDPV
DPDPVDPEPVDPVIPDPTIPDIGQSDTPPITEHQFRPEVGSYLANNYAANTLFMTRLHDR
LGETQYTDMLTGEKKVTSLWMRNVGAHTRFNDGSGQLKTRINSYVLQLGGDLAQWSTDGL
DRWHIGAMAGYANSQNRTLSSVSDYHSRGQVTGYSVGLYGTWYANNIDRSGAYVDTWMLY
NWFDNKVMGQDQAAEKYKSKGITASVEAGYSFRLGESAHQSYWLQPKAQVVWMGVQADDN
REANGTLVKDDTAGNLLTRMGVKAYINGHNAIDNDKSREFQPFVEANWIHNTQPASVKMD
DVSSDMRGTKNIGELKVGIEGQVTPRLNVWGNVAQQVGDTGYSDTQGMLGMKYSF
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgccaactccccaaaattactcattcatcgccatagcggtatcagcagcattagcctct
atggtatttccctcccaggcggcctgggttgacgttgatagtctgccatccagtgggctg
gtcagtcagttgccgccggaattacaggctattattcccgctcaggccagtaccggtttc
accaaagtcgggaccatgcccaactacgtttatcagtggaacaccggcaccatcccggtt
tatggcaatggcctcacgcttaatgggccgggcgcggaggcgtttgaacacactgtcacg
gttattcaaaacagcgggacgggaagtccgggcgtgatttttggcaacgacctgaccatt
cggacgcagtcggcgaatgccgcgaataatggtagagacgtcgatggcatccgtactcac
ggcgcgaatactccggataacccggtatttattattaccggtgaccgtacccgcatctac
gtggatggtcaggatggtgacggtattaacgccggatataactcactgggccagggttgg
accggatcggccaatatttacgtcggcgacgatctgtatatcaaaacgaccggtagccag
ggacgtggcattacagccaacgccatgcgggatgcgtcacgtgccaaaaatacgattgtc
gtcggcaatcgtgcgcatattgttactaccggcgacagttcggaggggctgcgtaccgga
caaagcggttcgttgattcgtctgggtgacgatgcaactatcgaaacatccggcgcatcc
tcaacggggatttacgcagcatcctcctccagaaccgagcttggcaacaacgctactatt
acggtgaacggtgccagcgcacacgcggtatatgcaactaacgctaccgttaatttggga
gagaatgccactattagcgttaacagcgccagtaaggctgcatcctatagtaaagcccct
gccggtttatacgccctctcccgaggcgccattaatctggcaggcggtgcggctattact
atggcgggcgataacagtagcgaaagttacgccatcagcacggagactggcggcattgtt
gacggttcttcaggaggtcgtttcgtcatcgacggtgatattcgtgctgctggcgccacc
gctgccagcggtacgctaccgcagcagaacagtacgattaagctcaatatgacggacaac
tcgcgatgggacggggcgtcgtacatcaccagcgctacggcgggcacaggcgttatctct
gtacaaatgagcgatgcgacctggaatatgaccagcagctcaacgctcactgacctgacg
ctgaatagtggcgcaaccattaacttcagccatgaagatggcgaaccatggcaaacgctc
accatcaatgaagattatgtaggcaacggcggtaagctggtctttaatactgtgctcaac
gatgatgattccgaaacggacaggctgcaggttctcggcaatacttcaggcaacacattt
gttgcagtaaataatattggaggagccggggcgcaaaccattgaaggtattgaaattgtt
aacgttgctggcaattccaacggtactttcgaaaaagcaagccgtattgttgccggagcc
tatgactacaacgtggtgcagaaaggtaaaaactggtatctgaccagctacattgagccg
gacgaaccgattattcctgatccagtagaccctgttatccctgaccctgtcgttcccgat
ccggtggaccctgatccagtagacccggttatccctgaccctgtgattcccgatccggtg
gaccctgatccagtagaccctgagccagtagacccggtcatccctgatccgacaattcct
gacatagggcaatctgacacaccgccgataacagaacatcagttccgtccggaagtgggc
agctatcttgccaacaactatgcggcaaatacgctgttcatgacgcgtctccatgaccgt
ctgggtgaaacccagtacaccgacatgctgacgggtgagaagaaggtcaccagcctgtgg
atgcgtaacgtcggcgcccatactcgcttcaacgatggcagcgggcagctaaaaacccgc
atcaacagctatgtgttacaactgggaggcgatctggcacagtggagcactgacggtctt
gaccgttggcatattggtgcaatggcaggttatgccaacagccagaaccgcacgctgtcg
tccgtgagtgactatcattcccgtggtcaagtcaccggttacagcgtcggcctttacggc
acctggtatgctaacaatatcgatcggtctggggcttatgtggatacctggatgctgtac
aactggtttgataacaaggtcatgggtcaggatcaggccgctgagaaatataaatccaaa
ggaattaccgcctcggttgaagccggttacagcttcaggttaggtgaaagcgcgcatcaa
agctactggttgcagcccaaagcgcaggtggtatggatgggcgtgcaggctgacgacaat
cgcgaagccaatggtaccctcgtcaaggatgataccgccggtaatctgctaacccgcatg
ggcgtaaaagcctatattaacggccacaatgctattgataacgataaatctcgagagttc
cagccattcgtggaagcgaactggatccataatacgcagcctgccagcgtgaagatggac
gatgtcagcagcgatatgcgtggtacgaagaatattggagaactgaaagtgggtattgaa
ggacaagttaccccgcgcctgaacgtatggggtaacgtggcgcaacaggtgggtgacaca
ggttatagtgatacccaaggaatgctggggatgaaatacagtttctga

DBGET integrated database retrieval system