KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM3775Help
Entry
STM3775           CDS       T00065                                 

Definition
(RefSeq) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00010  Glycolysis / Gluconeogenesis
stm00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:stm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STM3775
   00500 Starch and sucrose metabolism
    STM3775
Enzymes [BR:stm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     STM3775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 1255299
NCBI-ProteinID: NP_462674
UniProt: Q8ZL24
Position
3975955..3977337
Genome map
AA seq 460 aa AA seqDB search
MRYRFPDNFWWGSACSALQTEGDSLNGGKSQTTWDVWFERQPGRFHQGVGPAETSTFYRH
WKQDIALLKQLKHNSFRTSLSWARLIPDGVGEVNPQAVSFYNHVIDELLAQGITPFITLF
HFDMPMVMQEKGGWENRDVVEAFGRYAQTCFTLFGDRVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFKRAATVAYHTVLAHSTAVRAWRAGRYDGEIGIVLNLTPSYPRSQHPADVQAAH
HADLLFNRSFLDPVLKGEYPADLVALLKTYDQLPACQPGDRQLIADGKIDLLGINYYQPR
RVKCRDTAVNPQAPFMPEWLFDYYDMPGRKMNPYRGWEIYAPGIYDIITNLRDNYGNPRC
FISENGMGVENEQRFVQAGQIHDDYRIDFISEHLKWLHKGISEGCHCLGYHMWTFIDNWS
WLNGYKNRYGFVQLDLATQTRTVKKSGEWFAATAEHNGFD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgataccgttttcccgataacttctggtggggcagcgcctgctcagcgttgcaaacc
gaaggggatagtctgaatggcggtaaaagccagaccacgtgggatgtgtggttcgagcgc
cagccgggtcgttttcaccagggcgtcggtccagcggaaacctcaacgttctatcgccac
tggaagcaagacatcgcgctactgaaacagttaaaacataacagttttcgcacctcgcta
agctgggcgcggctcattccagacggcgtaggcgaggtgaatccacaagcggtgagcttc
tacaatcacgtcatcgacgagctactggcgcagggcatcacgccgtttattacgctgttc
cattttgatatgccgatggtcatgcaggagaaaggcggctgggaaaatcgcgacgtcgta
gaggcgtttggtcggtacgcgcaaacgtgttttaccttgtttggcgaccgcgtgaagcac
tggtttacctttaacgagccgattgtgccggtggaaggcggctatttgtacgacttccac
tatcccaatgtggtggattttaaacgggcggccaccgtggcgtaccataccgtgctggcg
cactcgaccgccgtgcgcgcctggcgcgccgggcgctacgacggtgaaatcggcatagta
ctgaatctgacgccgtcctacccacgctcgcagcatcccgccgatgtgcaagccgcgcac
catgcggatctgttattcaaccgcagttttcttgacccggtattaaagggagaatacccg
gcggacttggtggcgctgctgaaaacctatgaccagttgcctgcctgtcagccaggcgac
cgtcagcttattgccgacggcaaaatcgatttactggggattaactattatcagccgcgc
cgcgtgaaatgccgtgatacggcggtgaatccgcaagcgccgtttatgccggagtggtta
tttgactattacgacatgccggggcgcaagatgaacccttaccgcggctgggaaatttac
gcgccaggaatttacgacatcatcaccaacctgcgggataattacggcaatccgcgctgt
tttatctccgaaaacgggatgggcgttgagaacgagcagcgttttgtgcaagcgggacag
attcacgatgattaccggattgactttatttctgagcatcttaaatggctgcataaaggc
attagcgagggctgtcactgtcttggctaccacatgtggacctttatcgataactggtca
tggctgaacggctataaaaatcgctatggttttgtacaactggatttagccacccaaacg
cgcacggtgaaaaaaagcggagaatggtttgccgccaccgcagagcataacggttttgat
taa

DBGET integrated database retrieval system