KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM4105Help
Entry
STM4105           CDS       T00065                                 

Gene name
metF
Definition
(RefSeq) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00670  One carbon pool by folate
stm01100  Metabolic pathways
stm01120  Microbial metabolism in diverse environments
stm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    STM4105 (metF)
Enzymes [BR:stm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     STM4105 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 1255632
NCBI-ProteinID: NP_462986
UniProt: P11003
Position
4318541..4319431
Genome map
AA seq 296 aa AA seqDB search
MSFFHANQREALNQSLAEVQGQINVSFEFFPPRTSEMEQTLWNSIDRLSSLKPKFVSVTY
GANSGERDRTHSVIKGIKERTGLEAAPHLTCIDATRDELRTIARDYWNNGIRHIVALRGD
LPPGSGKPEMYAADLVGLLKEVADFDISVAAYPEVHPEAKSAQADLLNLKRKVDAGANRA
ITQFFFDVESYLRFRDRCVSAGIDVEIIPGILPVSNFKQAKKFADMTNVRIPSWMSLMFE
GLDNDAETRKLVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPGL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttttcacgccaaccagcgggaagccctgaatcagagcctggcggaagtacag
ggtcagattaacgtttcgtttgaatttttcccgccgcgcaccagtgaaatggagcaaacc
ctgtggaactccatcgatcgcctgagcagtctgaaaccgaagtttgtttcggtaacgtat
ggcgccaactccggggaacgcgaccgcacccatagcgttattaaaggcatcaaagagcgt
actgggcttgaggccgcgccgcaccttacctgtattgacgccacgcgcgatgaactgcgc
accatcgcccgcgactactggaataacggtatccgccacattgtcgctttgcgcggcgat
ttgccgccgggcagcggtaagccggagatgtacgccgccgatctggttggtttgctcaaa
gaggtggccgatttcgatatttcagtagcggcctatccggaggtacatccggaagcgaaa
agcgcgcaggccgatctgcttaatctgaagcgtaaagtggatgctggcgctaaccgcgcg
ataacccaatttttcttcgatgtggaaagctacctgcgttttcgcgaccgctgtgtttct
gccggtatcgacgtagaaattattcccggcattttaccggtgtctaactttaaacaggca
aaaaaatttgccgatatgaccaatgtccgcattccgtcctggatgtcactgatgtttgag
gggctggataatgacgcagaaacccgcaagctggtgggcgctaacattgcgatggacatg
gtgaaaattttaagccgtgaaggagtgaaggatttccacttctacacgttgaatcgtgcg
gaaatgagttatgccatttgccacacgctgggcgtaagaccgggtttataa

DBGET integrated database retrieval system