KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM4146Help
Entry
STM4146           CDS       T00065                                 

Gene name
tufB
Definition
(RefSeq) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
Translation factors [BR:stm03012]
 Eukaryotic Type
  Elongation factors
   STM4146 (tufB)
 Prokaryotic Type
   STM4146 (tufB)
Mitochondrial biogenesis [BR:stm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    STM4146 (tufB)
Exosome [BR:stm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   STM4146 (tufB)
  Exosomal proteins of breast cancer cells
   STM4146 (tufB)
  Exosomal proteins of colorectal cancer cells
   STM4146 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 1255672
NCBI-ProteinID: NP_463015
UniProt: P0A1H5
Position
4360616..4361800
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETQKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgccattactaccgtactggctaaaacctac
ggcggtgccgctcgcgcattcgaccagatcgataacgcgccggaagaaaaagcgcgtggt
atcaccatcaacacttctcacgttgaatacgataccccgacccgccactacgcacacgta
gactgcccggggcacgccgactatgttaaaaacatgatcaccggtgctgctcagatggac
ggcgcgatcctggttgttgctgcgactgacggtccgatgccgcagacccgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgaaatggaagttcgtgaacttctgtctcag
tacgacttcccgggcgacgacacgccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggcttcctggattcttacatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagaacgcggtatcatcaaagtgggc
gaagaagttgaaatcgttggtatcaaagagactcagaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgccggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcaccatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagatgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgttgctaaagttctcggctaa

DBGET integrated database retrieval system