KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM4298Help
Entry
STM4298           CDS       T00065                                 

Gene name
melA
Definition
(RefSeq) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Pathway
stm00052  Galactose metabolism
stm00561  Glycerolipid metabolism
stm00600  Sphingolipid metabolism
stm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    STM4298 (melA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    STM4298 (melA)
   00600 Sphingolipid metabolism
    STM4298 (melA)
Enzymes [BR:stm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     STM4298 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C
Motif
Other DBs
NCBI-GeneID: 1255824
NCBI-ProteinID: NP_463163
UniProt: P30877
Position
4542414..4543769
Genome map
AA seq 451 aa AA seqDB search
MMTAPKITFIGAGSTIFVKNILGDVFHREALKSAHVALMDIDETRLEESHIVVRKLMDSA
GASGRITCHTNQKAALQDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGI
MRALRTIPHLWRICEDMTEVCPKATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTA
EELARDLNIDPTSLRYRCAGINHMAFYLELERKTADGTYVNLYPELLAAYDAGQAPKPNI
HGNERCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIARYKVPLDEYPKRCV
EQLANWHKELEEYKTAERIDIKPSREYASTIMNALWTGEPSVIYGNVRNEGLIDNLPQGS
CVEVACLVDANGIQPTKVGTIPSHLAAMMQTNINVQTLLTEAILTENRDRVYHAAMMDPH
TAAVLGIEEIYALVDDLIAAHGDWLPAWLRR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggcacccaaaattacctttatcggcgcaggttctacgattttcgtcaaaaat
atcctcggcgatgtgtttcaccgcgaggcgctaaagtcagcgcatgtcgccctgatggat
attgacgaaacccggctggaagagtcgcacattgtggtacggaaactgatggactcagcg
ggcgcttctggccggattacctgccataccaaccagaaagcggcgctacaggatgcggat
ttcgtggtggtcgcctttcagattggcggctatgaaccctgcaccgtgaccgattttgag
gtttgtaagcgtcatggcctggaacagacgatcgccgatacgctggggccgggcggcatc
atgcgcgcgctgcggaccatcccgcatctgtggcggatttgcgaagacatgacggaagtc
tgtccgaaggccaccatgctcaattacgtcaacccgatggcgatgaatacctgggcgatg
tatgcccgttatccgcatatcaaacaggtcggcctgtgccattcggtacagggaacggcg
gaagaactggcgcgcgacctgaatatcgatcccacctcgctgcgctaccgctgcgccggc
attaaccacatggcgttttacctcgaactggagcgcaaaacggctgacgggacttatgtc
aatctctatcctgaattgctggcggcctatgacgccggacaggcgccgaagcccaatatt
cacggcaatgaacgctgccagaacatcgtgcgctatgagatgttcaaaaagttgggctac
ttcgtcactgagtcatcagagcattttgccgagtacacgccgtggtttattaaaccggga
cgcgaggatctgattgcgcgctacaaggtgccgctggatgaatatccgaaacgctgcgta
gaacaactggcgaactggcataaagagctggaggagtataaaaccgccgagcgtatcgac
atcaaaccgtcccgcgagtacgccagcaccattatgaacgctctgtggaccggcgagccg
agcgtgatttacggcaatgtgcgtaacgaggggctgattgataacctgccgcagggaagc
tgcgtggaagtggcttgtctggtggatgccaacggcattcaaccgacgaaggtggggacg
atcccttcccatctggcggcgatgatgcagaccaacatcaacgtgcaaacgctgttgacc
gaagccatcctcacggaaaaccgcgatcgcgtgtatcacgcggcgatgatggaccctcat
accgcagcggtgctgggtatcgaagaaatctatgcgttggttgacgatctgatcgccgcg
catggcgactggcttccggcctggttacgccgttaa

DBGET integrated database retrieval system