KEGG   Salmonella enterica subsp. enterica serovar Typhimurium LT2: STM4456
Entry
STM4456           CDS       T00065                                 

Gene name
mgtA
Definition
(RefSeq) magnesium-translocating P-type ATPase
  KO
K01531  P-type Mg2+ transporter [EC:7.2.2.14]
Organism
stm  Salmonella enterica subsp. enterica serovar Typhimurium LT2
Brite
KEGG Orthology (KO) [BR:stm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    STM4456 (mgtA)
Enzymes [BR:stm01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.14  P-type Mg2+ transporter
     STM4456 (mgtA)
Motif
Pfam: E1-E2_ATPase Hydrolase Cation_ATPase_N Cation_ATPase_C Cation_ATPase Hydrolase_3 COX7C HAD
Other DBs
NCBI-GeneID: 1255982
NCBI-ProteinID: NP_463316
UniProt: P36640
Position
4699706..4702414
AA seq 902 aa
MLKIITRQLFARLNRHLPYRLVHRDPLPGAQTAVNATIPPSLSERCLKVAAMEQETLWRV
FDTHPEGLNAAEVTRAREKHGENRLPAQKPSPWWVHLWVCYRNPFNILLTILGGISYATE
DLFAAGVIALMVGISTLLNFVQEARSTKAADALKAMVSNTATVLRVINENGENAWLELPI
DQLVPGDIIKLAAGDMIPADLRIIQARDLFVAQASLTGESLPVEKVAATREPRQNNPLEC
DTLCFMGTNVVSGTAQAVVMATGAGTWFGQLAGRVSEQDNEQNAFQKGISRVSMLLIRFM
LVMAPVVLIINGYTKGDWWEAALFALSVAVGLTPEMLPMIVTSTLARGAVKLSKQKVIVK
HLDAIQNFGAMDILCTDKTGTLTQDKIVLENHTDISGKPSEHVLHCAWLNSHYQTGLKNL
LDTAVLEGVDETAARQLSGRWQKIDEIPFDFERRRMSVVVAEDSNVHQLVCKGALQEILN
VCTQVRHNGDIVPLDDNMLRRVKRVTDTLNRQGLRVVAVATKYLPAREGDYQRIDESDLI
LEGYIAFLDPPKETTAPALKALKASGITVKILTGDSELVAAKVCHEVGLDAGDVIIGSDI
EGLSDDALAALAARTTLFARLTPMHKERIVTLLKREGHVVGFMGDGINDAPALRAADIGI
SVDGAVDIAREAADIILLEKSLMVLEEGVIEGRRTFSNMLKYIKMTASSNFGNVFSVLVA
SAFLPFLPMLPLHLLIQNLLYDVSQVAIPFDNVDEEQIQKPQRWNPADLGRFMVFFGPIS
SIFDILTFCLMWWVFHANTPETQTLFQSGWFVVGLLSQTLIVHMIRTRRLPFIQSRAAWP
LMAMTLLVMVVGVSLPFSPLASYLQLQALPLSYFPWLIAILVGYMTLTQLVKGFYSRRYG
WQ
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgctaaaaatcattacccgccagctttttgcccggcttaatcgtcatttgccttatcgt
ctggttcaccgcgatccgctgcccggcgcgcagaccgcggtaaatgcgactatcccgcct
tcgctgagcgagcgctgtctgaaagtcgcggcaatggagcaggagactctctggcgcgtt
tttgatacgcacccggagggattaaacgctgccgaggtgacgcgcgcgcgtgaaaagcat
ggcgaaaaccgccttccggcacagaaaccctcgccgtggtgggtgcatctgtgggtatgt
tatcgcaatcctttcaacatcttactcacgattcttggcggcatttcttatgccacggag
gatctgtttgccgcaggcgttatcgccctgatggtcggtatctcaacgctgctgaatttt
gtgcaggaagcgcgctcgacaaaagcggcggacgcgctaaaagcgatggtgagcaatacc
gctaccgtactgcgggttattaatgaaaatggcgaaaatgcctggctggaattacccatc
gatcaactggtgcccggcgatattattaagctggcggcgggggatatgatcccggcggat
ttacggattatccaggcgcgcgatctgtttgtcgcccaggcgtcgctgaccggcgaatct
ctgccagtcgagaaagtcgccgcgacgcgtgagccccggcaaaataacccgcttgagtgc
gacacgctgtgctttatggggacgaacgtcgtgagcggaacggcgcaggccgtggtgatg
gcgaccggcgccggcacctggtttggtcaattggcggggcgcgtgtcggaacaagataac
gagcagaacgctttccagaaaggaattagccgcgtcagtatgttgctgatccgctttatg
ctggtcatggcgccggtagtactgattattaatggttacacgaaaggtgactggtgggaa
gcggcgctatttgcgctctcggtcgcggtagggctcaccccggaaatgttgccgatgatc
gtcacctccaccctcgcgcgcggggcggtgaagctctcgaaacagaaagttatcgtgaag
caccttgatgcgattcagaacttcggcgcgatggatattctgtgcactgataaaaccggc
actctgacgcaggataaaattgtgctggagaatcacacggatatttctggtaagcccagc
gagcatgtactgcattgcgcctggctgaacagccattatcagaccggtctaaaaaattta
ctggatacggcggtcctggagggagtagacgaaaccgccgcgcgtcagctctccggacgc
tggcagaaaatcgatgagatcccgtttgattttgagcgtcgccggatgtcggtagtggtc
gccgaagattcgaacgtgcatcaactggtctgcaaaggcgcgttacaggagatcctgaac
gtgtgtactcaggtgcgccacaacggcgatattgtgccgctggacgacaatatgctgcgc
cgggtgaaacgcgttaccgacacgctgaaccgtcaggggctacgcgtggtcgccgtcgcg
accaaatacctgcctgcgcgtgagggcgattaccaacgtatcgatgagtctgacctcatt
ctggaagggtatatcgcttttctcgatccgccgaaagagaccaccgcgccggcgctgaaa
gcgctgaaggcgagcggaattacggtgaaaattctcaccggcgacagcgagctggtagcg
gcgaaagtttgccatgaggttgggctggatgcgggcgatgtcattattggcagtgatatt
gaagggttaagcgacgacgcgctggcggcgctggccgcccgtacgacgttgtttgcgcgt
ctgacgccgatgcataaagagcgcatcgtcactttactcaaacgcgaggggcatgtggtc
ggttttatgggcgacgggattaacgatgctccggcgttgcgggcggcggatattggtatc
tcggtagatggcgcggtggacatcgcccgtgaagcggccgatattatcctgctggaaaag
agcctgatggtgctggaagaaggcgtcattgaaggtcgtcgtactttttctaatatgttg
aaatatatcaagatgacggccagctcaaatttcggtaacgtgtttagcgtactggtggcg
agcgcctttttgccgttcctgccaatgctgccgctgcacttgctgattcaaaacctactg
tacgatgtatcccaggtggcgattccgtttgataatgtcgatgaagaacaaattcaaaag
ccgcagcgctggaatccggcggatttggggcgctttatggtctttttcggtccgatcagc
tcgattttcgacattttgaccttttgtctgatgtggtgggtatttcatgcgaatacgcca
gaaacgcaaactttgttccagtccggctggtttgtggtgggattactgtcgcaaacgctg
attgtgcatatgatccgtacccgccgtctgccgtttattcaaagtcgcgccgcttggccg
ctgatggcgatgacattgttggtgatggtggtgggagtctcgttgccgttttcgccgctg
gcgtcttacctgcagttgcaggcgctgccgttaagctatttcccgtggctgattgccatt
ctggtgggatatatgacgttaacccagttggtgaaagggttttacagcagacgttatggc
tggcagtaa

DBGET integrated database retrieval system