KEGG   Streptococcus thermophilus ND03: STND_0782Help
Entry
STND_0782         CDS       T01978                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase 2
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
stn  Streptococcus thermophilus ND03
Pathway
stn00670  One carbon pool by folate
stn01100  Metabolic pathways
stn01120  Microbial metabolism in diverse environments
stn01200  Carbon metabolism
Module
stn_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:stn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    STND_0782
Enzymes [BR:stn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     STND_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DUF719
Motif
Other DBs
NCBI-ProteinID: ADQ62841
Position
753732..755402
Genome map
AA seq 556 aa AA seqDB search
MKTDIEIAQSVELKPITEVVEKVGIGFDDLELYGKYKAKLSFDKINEVKDDKPGKLILVT
AINPTPAGEGKSTMSIGLADALNKIGKKTMIALREPSLGPVMGIKGGAAGGGYAQVLPME
DINLHFTGDMHAITTANNALSALLDNHIHQGNALGIDQRRIIWKRVVDLNDRALRHVTVG
LGGPLNGIPREDGFDITVASEIMAILCLATDINDLKERLANIVVAYRYDRTPVYVRDLEI
EGALTLILKDAIKPNLVQTIYGTPALVHGGPFANIAHGCNSVLATSTALRLADYTVTEAG
FGADLGAEKFLDIKTPNLPTTPDAVVIVATLRALKMHGGVAKTDLSEENVQAVRDGFSNL
KRHVENIRKFGIPAVVAINEFVADTEAEIAALKELCSEIKVPVELASVWANGADGGIDLA
NTVVDVVENGNADYKRLYSDDDSLEEKITKIVTEIYGGKSVIFEKKAKNQLKQFAEFGWD
KLPVCMAKTQYSFSDNQFLLGAPEGFDITIREFVPKTGAGFIVALTGDVMTMPGLPKAPA
ALKMDVTEDGTAVGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatattgaaattgctcaaagtgtagaattaaaaccaatcacagaagtagtt
gaaaaagttggaatcggctttgacgatttggaactctacggaaaatataaggcaaaattg
tcatttgataaaatcaatgaagtcaaagacgacaaaccaggaaaattgattttggtaaca
gccatcaatccaacaccagcaggtgaaggtaaatcaaccatgtcaattggtcttgcagac
gctcttaacaaaattggtaagaaaacaatgattgcccttcgtgaaccatctcttggtcct
gttatggggattaaaggtggtgctgcaggtggtggttacgctcaagttcttccaatggag
gatatcaatctccacttcacaggtgatatgcacgctattactacagcgaataatgccttg
tcagcccttcttgacaatcatattcatcaaggaaacgccctaggtattgatcaacgtcgt
attatttggaaacgtgtcgttgaccttaatgaccgtgctcttcgtcatgtgacagttggt
cttggtggcccactcaatggtatcccacgtgaagatggttttgatattaccgtagcctct
gaaatcatggcaattctttgcttggctactgatatcaatgaccttaaagaacgcttagct
aacattgtcgttgcttaccgttatgaccgtacacctgtttatgtacgtgatcttgaaatc
gaaggtgcgcttacacttattctaaaagatgccatcaaacctaacttggtacagacaatt
tatggcacaccagccttggtacatggtggtccatttgccaacatcgctcacggatgcaac
tcagttctagctacatctacagcacttcgcttggcagactacacggtcactgaagcaggt
ttcggtgcagaccttggtgctgaaaaattccttgatattaaaactccaaacctaccaaca
actccagatgctgtcgttattgttgctacacttcgtgctcttaagatgcatggtggtgtc
gctaaaactgacctttctgaggaaaatgttcaagccgttcgcgatggcttttcaaactta
aaacgtcatgtagaaaatatacgtaaatttggtattccagcggttgttgccattaacgaa
tttgttgctgacacagaagctgaaatcgcagctcttaaagaactttgttcagaaatcaag
gttcctgttgaattggctagcgtttgggctaatggtgctgatggtggtattgaccttgct
aatacagtagtggatgttgttgaaaatggcaatgctgattacaaacgtctctattcggat
gatgatagcttggaagaaaagattactaagattgttactgaaatctatggtggtaaatca
gttatcttcgagaaaaaagctaaaaatcaactcaaacagtttgcagaatttggttgggat
aaattgccagtatgtatggctaaaacacaatatagtttctcagataaccaattcttgctt
ggagcaccagaaggttttgatatcactattcgtgagtttgttcctaaaacaggtgctgga
ttcatcgtggctctcacaggtgatgttatgaccatgccaggtcttccaaaagccccagcg
gccctcaagatggatgttactgaagatggaacagcagttggtttgttctaa

DBGET integrated database retrieval system