KEGG   Sulfurisphaera tokodaii: STK_00510
Entry
STK_00510         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: HTH_10 HTH_24 MerR HTH_5 PROPPIN MerR_1
Other DBs
NCBI-ProteinID: BAK54134
UniProt: F9VMI8
Position
67667..68326
AA seq 219 aa
MRNFSNYPIKLVTLHIIHENCWSRYYLNDDLVKILDLIPYMEKNLLRVFAITSEKGYKTI
EKLKFDGKIKEIFNVYRNGNGIFVDLARDFDSSVLSIINKNNGIVLNTAKYEGMEIWNIL
IYEHKINRMLKELDEIAQIEKIKISDHIPLTNTLSDNELKILSIAYENGYFDYPRKIKSG
ELANLLGISQSTLIYYLRNAERKIIGQFLRKSRMEQTDE
NT seq 660 nt   +upstreamnt  +downstreamnt
atgagaaactttagcaattaccccataaagctcgtaactcttcatataatacatgagaat
tgctggagtagatattatttaaacgatgatttagtgaagatattggatttgataccttat
atggagaagaaccttttaagagtatttgcaataacttctgaaaaggggtataaaaccata
gaaaaattaaagtttgatggcaaaataaaagaaatatttaatgtatatagaaatggtaat
ggaatattcgtagatttggctagagattttgatagttctgttctgtctattataaataaa
aataatggaattgttttaaatactgcaaaatatgaaggaatggaaatatggaatattcta
atttacgagcataaaattaatagaatgctcaaggaattagatgagatagcacaaattgag
aagattaaaataagtgatcatattccgcttactaataccttatccgataatgagttaaaa
attctttcaatagcttatgaaaatggttatttcgattatccaaggaaaattaagtctgga
gaattagctaatcttctcggcataagtcagtcaacattaatttactatttaagaaatgca
gaaagaaaaataatagggcaattcttgagaaagagccgtatggagcaaactgatgaataa

DBGET integrated database retrieval system