KEGG   Sulfurisphaera tokodaii: STK_00530
Entry
STK_00530         CDS       T00062                                 
Symbol
adh
Name
(GenBank) NAD-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00010  Glycolysis / Gluconeogenesis
sto00071  Fatty acid degradation
sto00350  Tyrosine metabolism
sto00620  Pyruvate metabolism
sto00625  Chloroalkane and chloroalkene degradation
sto00626  Naphthalene degradation
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STK_00530 (adh)
   00620 Pyruvate metabolism
    STK_00530 (adh)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STK_00530 (adh)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    STK_00530 (adh)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STK_00530 (adh)
   00626 Naphthalene degradation
    STK_00530 (adh)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STK_00530 (adh)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N Methyltransf_12 Methyltransf_25 PIN_12
Other DBs
NCBI-ProteinID: BAK54135
UniProt: F9VMI9
Position
complement(69875..70909)
AA seq 344 aa
MKAMLIKEFGKPLKLEDVDVPKLKQNQVLIRVRSAGVCHTDVSVRSGTIYKRVSVNPPKL
PFIPGHEIAGIIEDVGDEVIGFTKGDKVIVNPWQGEGNCYYCKIGEEQYCDFPTWLGIST
NGGYAEYVVSNFNYVYKVNKLSVEEASPLACAGVTAYRAARLANLTPSKYVMVIGAGGGL
GSFGVQIVKALYGSTVIAVDINEEGLKLASRLGSDYVMNAKDQSLLQEILRITEGRGVDA
ILDFVGSESTTKNYYTILAKLGRYIKVGTFGGGLPQEAGLKLHSMGWEFIGTLTGNRRDF
LEIIKLAESGKIRIVITKLSLEEANEALNNLESNKVTGRQVLIP
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaaagctatgttgattaaggaatttggaaagccgttaaaattagaagatgttgatgtt
cctaagcttaagcaaaatcaagttctcattagagtaagaagtgcgggcgtatgtcatact
gatgtatcagtaagaagtggtacaatatataagagagtatctgtaaatccgcctaaacta
ccctttattcctggacatgaaatagcaggaataatagaagatgttggagatgaggttata
ggatttacaaaaggagataaggttatagtaaatccttggcaaggagaggggaattgctac
tactgtaagataggagaagaacaatattgtgattttcctacatggttaggaataagtact
aatggtggttatgctgaatatgtagtttctaactttaactatgtatataaagtaaataag
ttatcagtagaggaggcttcacctttagcttgtgcgggagttacggcttatagggctgct
agactagccaatttaactccatctaaatatgttatggttataggtgcgggaggcggatta
ggaagtttcggagttcaaatagttaaagcattatatggttctactgtgatagcagtagac
atcaatgaagagggattaaaattagcgtcaagattaggatctgactatgtcatgaatgct
aaagatcaaagtttacttcaagaaatattgaggataactgagggaagaggagttgatgca
atattagactttgtgggatctgagagtactacaaaaaactattatacaatattagcaaaa
ttaggtagatacattaaagttggtacttttggtggaggtttgccacaagaagctgggtta
aagttacactcaatgggttgggaatttattggtactctaactggtaatagaagagatttt
ctagaaattataaaattggctgaaagtggaaagataagaattgttataaccaaattatcg
ttagaagaagctaatgaagctttaaataatttagaatctaataaagtaacgggaaggcaa
gtattaataccttaa

DBGET integrated database retrieval system