KEGG   Sulfurisphaera tokodaii: STK_00750
Entry
STK_00750         CDS       T00062                                 
Name
(GenBank) putative alcohol dehydrogenase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Epimerase RmlD_sub_bind Oxidored_nitro Polysacc_synt_2 DUF6370 KR
Other DBs
NCBI-ProteinID: BAB65032
UniProt: Q976W4
Position
97632..98567
AA seq 311 aa
MKAAVLYNFNESFKIEDSQPRGVGVKVNVVATGICGRDIVIWKGGFRNLKTPIILGHEIV
GYYNGKPVAVYPNIYCGKCEYCKKGKENLCDNAIIIGENQNYSGGYAEEVIVPETNLIPL
PDEKFEKYAAALDPVATAIHATKLVELNDESKVLVTGGGGGVGIHLIQYLKYLGVKEVYA
LTSKIDKVKEFTEYIINDVKGHKFDVVFELVGAKTINDSLRALNKEGTLVLIGNVEGEPI
TLSRPALSIMRQHKIIGSASYTKKEYEEAVKLIHENKIVPIYREYSLDDINQAYMDLVNR
KVFGRAVLKIR
NT seq 936 nt   +upstreamnt  +downstreamnt
atgaaggcggctgttctctataactttaatgagagttttaaaatagaagattcacaaccc
agaggtgtcggtgtcaaagtaaacgtggtagcaactggtatatgcggaagggatattgtt
atttggaaaggcggatttagaaacttaaaaacacccataattttaggtcatgaaattgtt
gggtactacaacggtaaaccagtagctgtatacccaaacatatattgtgggaaatgtgaa
tattgtaaaaagggaaaagaaaatctctgtgataatgctataataataggggaaaatcag
aactacagcgggggttatgcagaagaagttatagtaccagagactaatttaatacctctt
ccagacgagaagtttgaaaaatatgcagctgcactagatccggtagctacagcaattcat
gctacaaagctagttgaactaaacgacgaaagtaaagttctagttactggtggtggagga
ggagtaggtattcatttaattcaatacctaaagtacttaggagtaaaggaggtttatgcg
ttaacatctaaaatagataaagtcaaagaatttacggagtatataataaatgatgttaag
gggcataaatttgatgttgtgtttgagctagttggtgcaaagactataaatgattctttg
agggctcttaataaagaaggaactttagtactaataggaaatgttgaaggagaacctata
acgttaagcagaccggcattatccattatgagacaacacaagattataggatcagcttct
tatactaagaaggaatacgaagaagcagttaagttaattcatgaaaacaagatagttcca
atatacagagaatatagccttgatgatataaatcaagcttacatggatttagtaaatagg
aaggtttttggaagagctgtactaaaaattagataa

DBGET integrated database retrieval system