KEGG   Sulfurisphaera tokodaii: STK_00940
Entry
STK_00940         CDS       T00062                                 
Name
(GenBank) oxidoreductase FAD-binding/iron-sulfur subunit
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: FAD_binding_5 Fer2_2 Fer2 Fer2_3 TAL_FSA
Other DBs
NCBI-ProteinID: BAB65050
UniProt: Q976U6
Position
118302..119618
AA seq 438 aa
MSFVLGIPKKFKYIKVNSLDEALELLRDGSKVLAGGQSLLPLLKLRILNVDTLIDIKNLD
LRGVKENEKEIEIYSLTTHNEVASKVKLLSKVAFTIADFQVRNKGTIGGSLAHADPSSNY
YPALLTLDAKVKVKSKKGEREIKISDLYLSPYTTSMREDEIITSIIIPKKKELNFTYEVY
KRGGSAYPTAIVAVAIEGNKYKVSFGGITEKPTLFEGEVEGESTIKNVIERLRKEKIISD
IHADSSTRLKIAERLFVNAFLKALKGVIDKLDIPNIENKWKSDMIRGEEMVKVRMKVNDF
EIEDEVEPRTLLLDFLRRNGYKEVKRGCDEGKCGACTVIINGKSIKSCLTLAVEVAGSDI
RTVKGLSDIKPIKDSFLENFAMQCGYCTHGFLMVTYDYLKRVGKRDNDELLRHSIKNICR
CTGYFNIIKAIKSSSLSQ
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgagctttgtgttaggtattcctaaaaagtttaagtacattaaggttaactctcttgat
gaagccttagagttacttagagatggatcaaaagtattagctggtggtcaaagcttatta
ccgctattaaaattaagaatacttaacgttgatactcttatagatataaagaatttagat
ttaaggggcgtaaaggaaaatgaaaaagaaattgagatttactcattaaccactcataat
gaagttgcttcgaaagttaaattactctctaaagttgcattcacaattgctgattttcaa
gttaggaataaaggaactataggaggctcattagcacacgctgatccttcaagtaattac
tatccggcgttactaacactagatgctaaagttaaggtaaagtctaaaaaaggcgaaaga
gagataaaaatttcagatttatacttatcaccttacactacttcaatgagagaagatgaa
ataataactagtattattatccctaagaagaaagagttaaacttcacttacgaagtttat
aagagaggtggctctgcatatcctacagctatagttgcagttgctattgagggaaataaa
tataaggttagctttggtggaataaccgagaaacctactttatttgaaggtgaagttgaa
ggtgaaagtactatcaaaaatgttattgaaaggttaagaaaggaaaaaattatttcagat
attcacgctgatagtagtactagattaaaaatagccgaaaggctgtttgtgaacgctttt
ttaaaggctttaaaaggagtcatagataaactcgatattccaaatattgagaataaatgg
aaaagtgatatgataagaggcgaggaaatggttaaagttagaatgaaagttaatgatttc
gaaatagaagatgaggttgaacctaggactcttcttttggatttcctaagaaggaatgga
tataaggaagttaaaagaggttgcgatgagggaaaatgtggtgcttgtacggtaatcata
aacggtaagtcgattaaatcatgtttgactctggctgttgaagttgcaggatcagatata
aggactgttaaaggactttcagatattaaaccgataaaggactctttcttagaaaacttt
gcaatgcaatgtggatattgtacacatgggtttttaatggttacttatgattatctaaag
agagtaggtaaaagggataatgacgagttacttagacatagcataaaaaatatttgtcga
tgtactggttactttaatattataaaagcaattaagtcttcttccttgagtcaataa

DBGET integrated database retrieval system