KEGG   Sulfurisphaera tokodaii: STK_00960
Entry
STK_00960         CDS       T00062                                 
Name
(GenBank) putative acyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00071  Fatty acid degradation
sto00280  Valine, leucine and isoleucine degradation
sto00310  Lysine degradation
sto00362  Benzoate degradation
sto00380  Tryptophan metabolism
sto00620  Pyruvate metabolism
sto00630  Glyoxylate and dicarboxylate metabolism
sto00650  Butanoate metabolism
sto00720  Carbon fixation pathways in prokaryotes
sto00900  Terpenoid backbone biosynthesis
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
sto01212  Fatty acid metabolism
sto02020  Two-component system
Module
sto_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
sto_M00375  Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STK_00960
   00630 Glyoxylate and dicarboxylate metabolism
    STK_00960
   00650 Butanoate metabolism
    STK_00960
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    STK_00960
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STK_00960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STK_00960
   00310 Lysine degradation
    STK_00960
   00380 Tryptophan metabolism
    STK_00960
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STK_00960
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STK_00960
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STK_00960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sto04147]
    STK_00960
Enzymes [BR:sto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STK_00960
Exosome [BR:sto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STK_00960
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III FAE1_CUT1_RppA ketoacyl-synt
Other DBs
NCBI-ProteinID: BAB65053
UniProt: Q976U3
Structure
Position
120801..121922
AA seq 373 aa
MVAIVDVGITKFGKRKENIFDLVKEVTEKLLKYDIDYVIVSNSYSGEFNQTSGLSSLITT
YLNLDYVPSLRVDNTSGSGGSAILVAKSLLESKEANTVLVVGVEKMSEKKTREVTKIISS
LLPFEERIASLPSLASISAIEYMRKFNAPRESIAQVAVKNHYNGSLNPFAHIQKRVTLEE
VLNSPVISEPLRLYEYTPISDGAAAVVMVRNEDALSYTSKPVYIKGIGSSNYTAYVSEKE
DFVTLPAVVEASRKAFKKAKVERIDFAELHDMATILEIIQSEDIGLFKKGEGWKAVMEGL
TSLDGEIPINPSGGLNSKGHPIGASGVAQAVEAFSQIRNEAGNRQVKNARVGLSLSMAGY
GNSATVIIYGDEP
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggttgctattgttgatgtaggaattacgaaatttgggaaaagaaaagaaaatatcttt
gaccttgttaaggaagttacagaaaaattactgaaatatgatattgattatgtaatagtt
tcaaattcatattctggagagtttaaccaaacctcaggattaagttcccttattaccacc
tatttaaatttagattatgtaccttctttaagggtagataacacaagcggaagtggagga
tcagcaatattggttgcaaaatctttactcgaatctaaagaagcaaacacagttttagta
gttggagttgagaaaatgtctgagaaaaagactagagaagtcactaaaattatctcgtca
ttattaccatttgaggaacgcattgcatctcttccttctcttgcatctatatctgcaata
gaatatatgagaaaatttaatgcacctagagaaagtatagctcaagtagctgtaaaaaac
cattataatggttcacttaatcctttcgcgcacatacagaagagagtaacattagaagaa
gtattgaattctccagttatttctgagcctctaagactttacgaatatacccctataagt
gatggagctgcagctgtagttatggttagaaatgaggatgcgttaagttatacttctaag
cctgtttacataaaaggaatagggagtagtaattacacagcgtatgtaagtgaaaaagaa
gattttgtgactttaccagcagtagtagaagcgtcaagaaaagcatttaagaaggctaaa
gttgaaaggattgattttgcagaattacacgatatggcaactatcctagaaattatacag
tctgaagatattggtttatttaagaagggtgaaggatggaaagcagttatggagggttta
acttcacttgatggagaaataccaataaatcccagtggtgggttaaattcaaagggtcat
cctataggggctagcggtgttgcacaagctgttgaagctttttcacaaattaggaatgag
gctggaaataggcaagttaaaaatgctagagttggtctttcgctaagcatggcgggttac
ggtaattctgcaactgtaattatatatggtgatgagccttga

DBGET integrated database retrieval system