KEGG   Sulfurisphaera tokodaii: STK_01590
Entry
STK_01590         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: HTH_24 CggR_N HTH_34 THUMP HTH_45 RinB TrmB MotA_activ HTH_9 MarR_2 Dynamitin
Other DBs
NCBI-ProteinID: BAB65115
UniProt: Q976N1
Position
185575..186093
AA seq 172 aa
MSKKFETYAEEFFSTRERILITLCKEDGITVRELINRSKISSSAYRSPLDFLIKIGLVKI
EKAGEKKMVVKLTNNGREVCKKLQELYEILKNMKPIVEIYPGLSLPVDELEKLVDKYLII
GGTPPRIMAVANDDEEARNKFLDLSDKADLNREADFPKAIIFLTRDMLKLYL
NT seq 519 nt   +upstreamnt  +downstreamnt
atgagtaaaaaattcgaaacttatgcggaggagtttttctccactcgcgaaagaatttta
attacgttatgtaaagaggacgggataacggttagggaattaataaataggtcaaaaatc
agttcttcagcttaccgttctcctctagatttcctaataaagataggattagttaaaata
gagaaagcaggagagaaaaagatggtagttaagctaactaataacggtagagaagtttgt
aaaaagctccaggaactttatgagatattaaaaaatatgaaacctatagtagaaatttac
cctggactatccttacctgtagatgagctggagaaactggttgataaatacctaattata
ggaggtacaccgccaagaataatggcagtagcaaacgacgacgaggaagctaggaacaaa
tttttagacttatccgataaagccgaccttaatagggaggctgattttcctaaggctata
atatttctaacaagagatatgttgaaactctatttatga

DBGET integrated database retrieval system