KEGG   Sulfurisphaera tokodaii: STK_01650
Entry
STK_01650         CDS       T00062                                 
Name
(GenBank) putative aminotransferase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Aminotran_1_2 Mei5 MukE
Other DBs
NCBI-ProteinID: BAB65122
UniProt: Q976M5
Position
192269..193240
AA seq 323 aa
MKHGGVKWGKDGPEHINDFSVNLNPLGTLPRVHELIDEAVKKRVYSFYPPEDYKEIKEFI
AELYNVDIDLIGVFNGSSEVIKLLDACDVPEPNFSEYKRKRSYFAIERENYFEYYLSGDC
VITSNPVNPTGSMIKEKDIINFLSFGRKLILDESFADISLIKSSIKYTEEFNNLLIISSF
TKSLSIPGLRIGFSIGKNSRKLEEKAPPWRINSIVYYVFVNLDPKEVRDFFERSKREIER
LISVLKSTKAKFKIYDTVAPYFLAEFPIPTKELNMKLRKYGYQIREPEGFLGLRPTHGRI
SLKNNFKELIFLINKILDCEKLY
NT seq 972 nt   +upstreamnt  +downstreamnt
atgaagcatggaggagtaaagtggggtaaggatggaccagaacatattaatgattttagt
gtgaatttgaatcctttaggaactttgcccagagtacatgaacttatagatgaagcggtg
aagaagagggtttactcattttatccaccagaagattataaggaaataaaggagtttata
gctgaactttataatgttgatattgatttaattggtgtttttaatggttcctcagaagta
ataaaactactagatgcttgtgatgttccagaaccaaatttttctgagtataagaggaaa
cgtagttattttgcaatagagagagaaaattactttgaatattatctctctggggattgt
gtcataactagtaatccagttaatcctactgggagtatgattaaagagaaggatattatc
aattttctatcctttggaagaaaattaatactagatgaatcttttgcagatataagtcta
ataaagagttctattaaatatactgaagagtttaataatcttcttataatttcatctttt
acaaaatccttatctattccagggttaagaataggtttttctattggaaagaattcaaga
aaattagaggagaaagcaccgccttggaggataaatagtattgtgtattatgtttttgtt
aatctagatcctaaggaggttagggatttttttgaaagatctaagagagagattgaaagg
cttattagcgttttaaaaagcactaaagctaaatttaaaatatatgatacagtagccccg
tattttttggctgaatttcctatccctactaaagagttaaatatgaagctaaggaaatat
gggtatcagattagagagccagagggttttttaggtttaagaccaacccacggcagaatt
tctttaaaaaataactttaaagagctaatatttttaataaataagattcttgattgcgaa
aaactttattaa

DBGET integrated database retrieval system