KEGG   Sulfurisphaera tokodaii: STK_01730
Entry
STK_01730         CDS       T00062                                 
Name
(GenBank) DNA-binding protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: TrmB MarR_2 TFIIE_alpha MarR Fe_dep_repress HTH_5 HTH_20 DUF4423 HTH_36 HTH_24 HTH_27 HTH_Crp_2 HTH_34 DUF2250 Rrf2 MCM_C HTH_micro HTH_23 HTH_CodY RPA_C PadR HTH_IclR SoFic-like_C RP-C tRNA-synt_His B-block_TFIIIC HTH_10 DUF92 Msg2_C
Other DBs
NCBI-ProteinID: BAB65130
UniProt: Q976L7
Position
complement(198601..198951)
AA seq 116 aa
MSIEITEKSVIFKRFLAVAYGLSEAEIEAFLKIMESKEGKNVDTISSELGISKSRASLIL
KKLSDAGLIEKEKSGNNKGGRPKFMYYVNKDEIRTKLEKKANELCDQLKQLISSLG
NT seq 351 nt   +upstreamnt  +downstreamnt
atgagtattgaaattactgaaaaaagcgtaatttttaagagattccttgctgtagcctat
ggactatcagaggcagaaatagaagcttttcttaaaatcatggaaagcaaagaaggtaag
aatgttgatacaatttctagtgaattaggaattagtaaaagtagagcgagtttaattctt
aaaaaactttcagatgctggcttgattgagaaggagaaaagtggaaataataaaggggga
agaccaaaattcatgtattatgttaacaaggacgaaataagaactaaattagagaaaaaa
gctaatgaattatgtgatcaattaaagcaacttatatcctctctgggttaa

DBGET integrated database retrieval system