KEGG   Sulfurisphaera tokodaii: STK_01925Help
Entry
STK_01925         CDS       T00062                                 

Gene name
lysW
Definition
(GenBank) alpha-aminoadipate carrier protein LysW
  KO
K05826  alpha-aminoadipate/glutamate carrier protein LysW
Organism
sto  Sulfurisphaera tokodaii
Module
sto_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
sto_M00763  Ornithine biosynthesis, mediated by LysW, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    STK_01925 (lysW)
   00220 Arginine biosynthesis
    STK_01925 (lysW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zinc_ribbon_4 TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: BAB65149
UniProt: Q976J8
Structure
PDB: 

Position
complement(216287..216457)
Genome map
AA seq 56 aa AA seqDB search
MVVLKCPVCNGDVNVPDDALPGEIVEHECGAQLEVYNDHGRLALRLAEQVGEDWGE
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcctaaagtgcccagtatgtaatggagatgtaaatgttccagatgatgcatta
cctggagaaatagttgagcatgaatgtggagcccaattagaagtatataatgatcatgga
agactcgcactaagattagccgagcaagtaggagaggactggggagagtga

DBGET integrated database retrieval system