KEGG   Sulfurisphaera tokodaii: STK_02020
Entry
STK_02020         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: TPP_enzyme_M TPP_enzyme_N PNTB ETF_alpha
Other DBs
NCBI-ProteinID: BAK54189
UniProt: F9VMP3
Position
complement(224601..226226)
AA seq 541 aa
MSQPKRKEETIGRETKGDEAIAYTFKELGIKEIFSPYNLPSFLAERLKQYEININYASSA
REAVMLADSYAREYNTLGVVLQSPGVYLTEAIDIIAQAFMDSVPLLLISTLRSYRDTGRS
RIAELKTQDDLMNILAPITKMRERVVSIEEIIITIEKGYKEALSNRNRPVYIEIAEDLFR
LKAYPLSPAEQKPEKKTPDKTTVAKVAEVLSNSKSPIIIAGYGVLASNSFDELKELAELL
DAPVIATFRSKGVIPASHPLYAGEGLGLFATEEGGRLLDEADVILALGTRFTQLSTAGWS
MKFKGYLIHNNVDGEDIGKVFIPQIPVVADTGLFLKELLTQLKAKIKEPIKRGSADKIKV
YRKIHILDSHGGLWPYDVVRTIQQFKFDKIFIDLTAPTIDFVRLHIEKPFSWIASESLLE
RNIAISGIVRASNNKIIGVTDLQGVIQNLSIIQNRLNKSHGILLILNDNGSTTIDAISSD
IPTISRTTSNLDIKDEILEKSLDAKTIQSISELKMELENLDENKLNVLNIKIEPDYKSVM
F
NT seq 1626 nt   +upstreamnt  +downstreamnt
gtgagtcaacccaaaagaaaagaggagacaataggaagagaaacaaaaggagacgaagcg
attgcttatacttttaaagagttaggaatcaaagaaatattttcaccttataatcttcca
tcatttttggctgaaagacttaaacaatacgaaattaatataaattatgcgtcaagcgcc
agagaggctgtaatgttagccgattcttatgcgagggaatataatacgcttggagtagtt
ttgcaatcccctggtgtttatttaactgaggctattgatataatagcccaagcatttatg
gactctgtaccacttctgcttatttcaactctaagatcttatagggatactggtagaagt
agaattgctgagttgaagacccaagatgatttaatgaatatattagctcctataacaaag
atgcgtgaaagagtagttagcatagaagaaataataataactatagagaaaggttataag
gaagcattaagtaatagaaataggccagtttatatagaaatagcagaagatttatttagg
ttgaaagcatatcctttatctcctgctgagcagaaaccggaaaagaaaacaccagataag
actacagtagcaaaagtcgcggaagtattatcaaattcaaaatcaccaataattattgct
ggttatggtgttttagcttctaactcttttgatgagttaaaagaacttgctgagttatta
gatgcaccagttatagctacttttaggagcaaaggagtaataccagcatcacatccgctt
tatgctggtgaaggcctaggtttatttgctaccgaagaaggaggcagactgcttgatgaa
gcagatgtgatattagctttaggaacaaggtttacacaactctctacagccggctggtca
atgaaattcaaaggctatcttattcataataatgttgatggtgaagatataggcaaagtt
tttattccacaaattccagtagtagcagatacaggcttattcttaaaagaactattaaca
cagcttaaggctaaaattaaggagccaataaagaggggttctgctgataaaataaaggta
tatagaaaaatacacattttagattctcatggaggtttatggccttatgatgtagtaagg
actattcagcaattcaagtttgataagattttcatagatctaactgctccaacaatagat
tttgtaagattgcatatagagaagccttttagttggatagctagtgaatccttactagaa
agaaatatagctattagtggtatcgtaagggcatcaaacaataagattataggagttaca
gacctacaaggggtaatacaaaatctatcaatcattcaaaataggttgaacaagagccat
ggaattctactaatattaaatgataatggaagtacaacaatagacgcaatctcatctgat
attccaactataagtagaactacttcaaaccttgatattaaagacgaaattctagagaaa
agtctggatgctaaaacaatacagagtattagcgagctaaaaatggaattagaaaactta
gatgaaaataaattaaacgtactaaatataaagattgaacccgattacaaatctgtaatg
ttttaa

DBGET integrated database retrieval system