KEGG   Sulfurisphaera tokodaii: STK_02120
Entry
STK_02120         CDS       T00062                                 
Symbol
hemA
Name
(GenBank) glutamyl-tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00860  Porphyrin metabolism
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
sto01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    STK_02120 (hemA)
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     STK_02120 (hemA)
SSDB
Motif
Pfam: GlutR_N Shikimate_DH GlutR_dimer F420_oxidored NAD_binding_2 GFO_IDH_MocA 2-Hacid_dh_C IlvN ThiF Sacchrp_dh_NADP Ldh_1_N NAD_Gly3P_dh_N ApbA Pyr_redox_2 NAD_binding_7 ELFV_dehydrog TrkA_N Pyr_redox DapB_N PglD_N FAD_binding_3 3HCDH_N DHQ_synthase
Other DBs
NCBI-ProteinID: BAB65173
UniProt: Q976H4
Position
235558..236796
AA seq 412 aa
MSDEFIDINNYIAIVYTYKTVGISKLYEHYVKDQELLLLKGLIKGEISVLQTCNRAETYL
YTYNKEEFKDFLQKLDEIHGKQISKDAMILKGEDAVKHLFEVASGLDSLAIGEYEILRQL
KESIEKSKKLGLSSEKLEFLFKNAIKVGRKIRQQTEISKGKTGIYALAVEYAKHVSNNNI
GNVKIAIVGAGEIGNKLALMLKNEGAQNVTIFNRTYEKALEVANKYGFKAEPLDFYKINN
YDIVFVAIYYDKKINLPNPKLVIDLSVPQIVLGNNVITLENLRSISDKIMETKILSLQKA
EELIHIEIENFKNEIIKYNQNRLISKFMKRIEDIREAEINRAYAEILKHANDKEEIKNII
DKMTNSMLKKIFSPLFETVRKNEDMANYINNIFEILSNGNISNSKTEEAKEK
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgagtgacgaatttatagatataaacaattatatagcaatagtatatacatacaaaaca
gttggaataagtaagttatatgaacattatgttaaagatcaagaattgttattgctaaag
ggactaataaagggagaaattagtgtattacaaacatgtaacagagcagagacatactta
tatacatataacaaagaagaatttaaagattttttacagaaattagatgaaattcatgga
aaacagattagtaaagatgctatgatcttaaaaggggaagatgcagtaaagcatttgttt
gaggtagcatctggtttagactcacttgctataggcgaatacgaaatacttagacaattg
aaagaaagcattgaaaaaagtaaaaaacttggattaagcagtgaaaaactagaatttctt
tttaaaaatgctataaaggtaggaagaaaaattagacaacaaacggaaatttcaaaagga
aaaactggtatatatgcattagctgttgaatatgctaaacatgtatcaaataataacata
ggcaatgtaaaaattgctatagtaggagccggagaaattggaaataaactagctctaatg
ttgaagaatgaaggagctcaaaatgttacaatatttaacagaacatacgaaaaagcgtta
gaagttgccaataagtatggttttaaagcagaaccattagatttttataaaataaataat
tatgatattgtatttgttgcaatatattatgataaaaaaataaatctaccaaatcctaaa
ctagtaattgatctttctgttccccagattgttttaggtaacaatgttattacgttagaa
aatttgagatctatctcagataaaataatggaaacaaaaatattaagtttacagaaagct
gaggaattaatccatatagagatagagaattttaagaatgaaattattaaatataatcaa
aatagacttatttctaaatttatgaaaagaatagaagatattagggaagctgaaataaat
agagcttatgcagaaattttaaaacatgctaatgataaagaagagataaagaatattatt
gataaaatgactaattcaatgcttaaaaaaatcttttcaccgctttttgaaaccgttaga
aaaaatgaagatatggcaaattacattaacaacattttcgaaatattaagtaatggtaac
atttccaactctaagaccgaggaggctaaggaaaaataa

DBGET integrated database retrieval system