KEGG   Sulfurisphaera tokodaii: STK_02280
Entry
STK_02280         CDS       T00062                                 
Name
(GenBank) protein-disulfide oxidoreducatase
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: Thioredoxin_3 Thioredoxin_2 Thioredoxin OST3_OST6 TrbC_Ftype Thioredoxin_7 NUMOD3
Other DBs
NCBI-ProteinID: BAK54203
UniProt: F9VMQ7
Position
complement(249088..249789)
AA seq 233 aa
MEEEFAELFTDEVKQALVDALKDMKNPVDIYVFIDSNDPHCHYCEVTKRFLQFMSDAAPK
DSEGKSLAVVHVIDRADPNSAEIFKEFRVERVPTVAFMKGYLRWTGAPLGEEIRALVETV
VRLSLGESGLSAETINAIKNKLNGYVKIETVVTPSCPYCPYAALMAHMVAYEACKAGKCN
VESDVVEAYENQDIAEKYQVMSVPTVAINESVEFIGVPYEENFINSLLEKQKL
NT seq 702 nt   +upstreamnt  +downstreamnt
atggaagaagaattcgcggaactctttacagatgaagtaaaacaagcccttgttgatgca
cttaaagacatgaagaatccagtagatatatatgttttcatagattctaatgatcctcac
tgtcattattgtgaggtaacaaaaaggtttctacaatttatgagtgatgctgcccctaag
gactctgaaggaaaaagtttagctgttgtacatgttattgatagggctgatcctaattct
gctgagatatttaaagaatttcgtgtagagagagttcccacagttgcctttatgaaaggt
tacctaagatggactggagcacctttaggtgaagaaataagagctctagtagaaacagta
gtgagactatcccttggagaaagtggactaagtgcagaaacaataaatgcgattaaaaat
aaattaaacggatatgtgaaaatcgagactgtggttactccgtcatgtccatattgtcca
tatgctgcattaatggctcatatggttgcttatgaagcatgtaaagctggaaagtgtaat
gttgaatctgatgtagttgaagcctatgagaaccaggatattgctgaaaaatatcaagta
atgagtgtacctactgtagctataaatgagtctgttgaatttattggtgttccttacgaa
gaaaacttcattaattcactattggagaaacaaaagttgtaa

DBGET integrated database retrieval system