KEGG   Sulfurisphaera tokodaii: STK_02420
Entry
STK_02420         CDS       T00062                                 

Definition
(GenBank) phosphohexomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00010  Glycolysis / Gluconeogenesis
sto00030  Pentose phosphate pathway
sto00051  Fructose and mannose metabolism
sto00052  Galactose metabolism
sto00230  Purine metabolism
sto00500  Starch and sucrose metabolism
sto00520  Amino sugar and nucleotide sugar metabolism
sto00521  Streptomycin biosynthesis
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STK_02420
   00030 Pentose phosphate pathway
    STK_02420
   00051 Fructose and mannose metabolism
    STK_02420
   00052 Galactose metabolism
    STK_02420
   00500 Starch and sucrose metabolism
    STK_02420
   00520 Amino sugar and nucleotide sugar metabolism
    STK_02420
  09104 Nucleotide metabolism
   00230 Purine metabolism
    STK_02420
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STK_02420
Enzymes [BR:sto01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     STK_02420
    5.4.2.8  phosphomannomutase
     STK_02420
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Other DBs
NCBI-ProteinID: BAB65203
UniProt: Q976E4
Structure
PDB: 
2F7L

Position
complement(261313..262680)
AA seq 455 aa
MGKLFGTDGVRGIVNKELTPELVLKLSKAIGTFFGKNSKILVGRDVRAGGDMLVKIVEGG
LLSVGVEVYDGGMAPTPALQYAVKTLGYDGGVVITASHNPAPYNGIKVVDKDGIEIRREK
ENEIEDLFFTERFNTIEWSSLTTEVKREDRVISTYVNGILSHVDIEKIKKKNYKVLIDPA
NSVGALSTPLVARALGCKIYTINGNLDPLFSARQPEPTFDSLKETAEVVKTLKVDLGVAH
DGDADRAIFIDSEGRVQWGDRSGTLLSYWASVKNPKAIKKIVTAVSSSSLVEEYLSKYNI
QVDWTKVGSVDIAHKVADENALAGFEENGGFMYPPHQYVRDGAMSFALMLELLANENVSS
AELFDRLPKYYLVKTKVDLKPGLMVEEIYKKILEVYSTSSVKAITIDGVKIIGKDFWFLV
RKSGTEPIIRIMAEAKDENVANNLVNELKKIVEGK
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgggtaagctttttggtactgacggagtaagagggatagttaataaagagttaactcca
gaattggtattaaagctttctaaagctatagggacattttttggaaagaatagtaaaatt
cttgtaggcagggatgtaagagcagggggtgatatgttagttaaaattgttgaaggtggt
ttactaagtgtaggtgttgaggtttatgatggtggtatggctcctacaccagctttacaa
tatgctgtgaaaactttgggttatgatggtggagttgtaattactgctagccataatcca
gcaccatataatgggataaaagttgttgataaggatggtattgaaataagaagagagaaa
gaaaatgaaatcgaggacttattttttactgaaagatttaatactatagaatggagttct
ctaactacagaagttaagagagaagatagagttatttctacttatgtaaatggaatttta
agtcatgttgatatagagaaaattaaaaagaaaaattataaggtattaattgatccggct
aatagtgtaggtgctttatctactccattagttgctagagctttaggttgtaagatttac
acgattaatggaaatcttgatcccttattttcagctagacaaccagagcctacttttgat
agtcttaaagagactgcagaagttgtaaagactttaaaagtggacttaggtgtagcacac
gatggtgatgctgatagagccatttttattgattctgaaggaagagtacagtggggtgat
aggagtggtactttattatcatattgggcatctgttaaaaatcctaaagctataaagaag
attgttactgctgtttcaagctcaagcttagtagaagagtatttaagtaaatataatatt
caagttgattggacaaaagtaggaagtgttgatatagcacataaggtagcggatgagaat
gcactagctgggtttgaagaaaatggaggttttatgtatcctccacatcagtatgtaagg
gatggtgcaatgagttttgctttaatgttagaattactagctaatgaaaatgtttcgtca
gcagagctatttgataggcttcctaaatattatcttgtaaaaactaaggttgacctaaag
ccagggttaatggttgaggaaatttataagaaaatattagaagtatattcaacttctagt
gttaaagcaataactatagacggagtcaaaatcataggtaaagatttctggtttcttgta
aggaaaagtgggactgaacctataataagaataatggctgaagctaaagatgaaaacgta
gcaaataatttagttaatgaattaaaaaagattgtagagggtaaatga

DBGET integrated database retrieval system