KEGG   Sulfurisphaera tokodaii: STK_02580
Entry
STK_02580         CDS       T00062                                 
Name
(GenBank) acetyltransferase
  KO
K03789  [ribosomal protein S18]-alanine N-acetyltransferase [EC:2.3.1.266]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sto03009]
    STK_02580
Enzymes [BR:sto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.266  [ribosomal protein bS18]-alanine N-acetyltransferase
     STK_02580
Ribosome biogenesis [BR:sto03009]
 Prokaryotic type
  ribosomal protein modification factors
   STK_02580
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 FR47 Acetyltransf_4 Acetyltransf_9 Acetyltransf_8 Acetyltransf_3 Acetyltransf_15 CFAP61_N GNAT_acetyltran
Other DBs
NCBI-ProteinID: BAB65224
UniProt: Q976C3
Position
275629..276132
AA seq 167 aa
MEFAEAKKGKEYRIRNARLTDVDQIIKINRLALPENYPYYFFVEHLKEYEAAFFVAEVDG
EVVGYIMPRIEWGFSNLKQLPTLVKKGHVVSIAVLEQYRRLGIGTALLQASMKAMKEVYN
AEEVYLEVRVSNSPAINLYKKLGFKEVKVLRHYYADGEDAYLMAAPL
NT seq 504 nt   +upstreamnt  +downstreamnt
atggagtttgctgaagcaaaaaagggaaaagaatatagaataagaaatgcaaggttaaca
gatgtagatcaaataataaaaattaatagattagctttgcctgaaaattatccctattat
ttctttgtagaacacctaaaggagtatgaagcggcattctttgtcgcagaagttgatgga
gaggtggtaggttatataatgcctagaatagaatggggatttagtaatctgaaacaatta
ccaacattagttaaaaaagggcatgttgtatctatagcagttctagagcaatatagaaga
ttaggcataggcactgcattacttcaagcctcaatgaaagcgatgaaagaggtttacaac
gcagaagaagtttatctagaagttagagtgagtaactcaccagcgattaatttatataaa
aaattagggtttaaagaagtaaaagtattaagacattattatgcagatggagaagatgct
tacctaatggctgctcctctttaa

DBGET integrated database retrieval system