KEGG   Sulfurisphaera tokodaii: STK_02775
Entry
STK_02775         CDS       T00062                                 
Symbol
rpoH
Name
(GenBank) DNA-directed RNA polymerase subunit H
  KO
K03053  DNA-directed RNA polymerase subunit H [EC:2.7.7.6]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    STK_02775 (rpoH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sto03021]
    STK_02775 (rpoH)
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     STK_02775 (rpoH)
Transcription machinery [BR:sto03021]
 Prokaryotic type
  Archaeal type
   RNA polymerase
    Core subunits
     STK_02775 (rpoH)
SSDB
Motif
Pfam: RNA_pol_Rpb5_C
Other DBs
NCBI-ProteinID: BAK54219
UniProt: Q976A3
Position
complement(295283..295537)
AA seq 84 aa
MRSSSKIKIDPSQHELVPKHEVLSIEEAYKILKELGIKPEQLPWIRASDPIAKLVGAKPG
DIIKITRKSSLSGEVVVYRYVISG
NT seq 255 nt   +upstreamnt  +downstreamnt
atgcgttcttcatcaaaaattaaaatagatcctagtcagcatgagcttgttcctaagcat
gaggtcctaagcatagaagaagcttataaaattcttaaggaattaggaataaaaccagag
caacttccttggattagagcatcagatcctatagctaaattagttggtgcaaaacctgga
gatataattaaaattaccagaaaaagctctttgtctggagaagtagttgtatatagatac
gttataagtgggtga

DBGET integrated database retrieval system