KEGG   Sulfurisphaera tokodaii: STK_02930
Entry
STK_02930         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: AsnC_trans_reg2 MCM_WH_arc HTH_AsnC-type HTH_36 HTH_24 Sigma70_r4 HTH_27
Other DBs
NCBI-ProteinID: BAB65263
UniProt: Q975Y5
Position
312827..313792
AA seq 321 aa
MELSEIDKKLIMELEYHFPFNEKPFSEISERLGISEEEIIKKTKELLSNEIIKRVGMYVN
FRAKGMEGALIAAEIPIENLEKYRKITLAIKELTHNYIRNHPKYNVWFVLKAESKDKLKE
NVKKILEESNGRDYVILFSKKTLKLSVKYDIIRGVSYSEPEEIHEKIPTAEELGIPKELL
KDLSLPLQITSRPFRNIAEKYNMKESELVELIKELKEKGVIKDYGATVNGDKVGIKENAM
MLVNSDDIESSCYNLAKNLKEATHVVLRESDKKWDYLCYAMIHGANKKIIFEVAKKGVEI
TKAKSYMLLFSLDNLKPGIVI
NT seq 966 nt   +upstreamnt  +downstreamnt
atggagctatcagaaatcgataagaagcttataatggagcttgaatatcattttcccttt
aatgagaaaccttttagtgaaatctcagaaaggcttggaatttctgaagaagagattata
aagaaaactaaggaattactgagtaatgagattataaaaagagtagggatgtatgtaaac
tttagagctaaaggaatggaaggggctctaatagctgctgagataccaatagaaaatttg
gaaaaatatagaaaaattacattagctataaaagaacttactcataattatattagaaac
catccaaaatataatgtttggtttgtattaaaagctgaaagcaaagataaattgaaagaa
aatgtgaaaaagattttagaagaaagtaatggtagagattatgtgattctgttctctaaa
aaaactcttaaacttagcgtaaaatatgatataataagaggtgtttcatatagcgaacca
gaagaaattcacgaaaaaatacctacagctgaagaattaggtattccgaaagagttattg
aaagacctttcacttccattacagattacttcaagaccgttcagaaatatagccgaaaaa
tataatatgaaagagagtgaattagtagaactaataaaagaacttaaagaaaaaggagtt
attaaagattatggagcaacagtaaatggcgataaagtaggaattaaagagaatgccatg
atgctagttaattcagatgatatagaatcctcttgttacaacttagctaaaaatctaaag
gaagctacacatgttgtattaagagaatcggataaaaaatgggactatttatgctatgct
atgatccatggagcaaataaaaaaataatatttgaagttgcaaaaaaaggagtcgaaatt
actaaagccaagagttatatgctactatttagcttagataatttgaaacctggtattgta
atttag

DBGET integrated database retrieval system