KEGG   Sulfurisphaera tokodaii: STK_02940
Entry
STK_02940         CDS       T00062                                 
Name
(GenBank) prephenate dehydrogenase
  KO
K04518  prephenate dehydratase [EC:4.2.1.51]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
sto01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STK_02940
Enzymes [BR:sto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     STK_02940
SSDB
Motif
Pfam: PDT ACT Thr_dehydrat_C
Other DBs
NCBI-ProteinID: BAB65264
UniProt: Q975Y4
Position
complement(313755..314363)
AA seq 202 aa
MNYEIEKEIKLVLAVNPSVNSLNDIEVIYSHSHAINEAKETLSKYNFTNFVPVESTSTAA
LYASKQKYSAAICSEYAANLYNLKIILRDINDSINITRFIVISKKLIEDGDKTMVMFTVP
HKPGALYKVLEKFYNNNINLTMIYSRPLKSIPWQYYFYLEFEGNIKDNKVKATLEEIRNI
TSMLKIKGSFTKLQYQVSNYLS
NT seq 609 nt   +upstreamnt  +downstreamnt
gtgaattatgagatagaaaaagagataaaattagttcttgcagtaaatccttccgttaat
agtttaaacgatatagaagttatctattctcattctcatgctataaatgaggcaaaagaa
acacttagcaaatacaattttactaattttgttccagtagaaagtacatctactgcagct
ttatatgcatctaaacaaaaatattctgctgcaatatgttcagagtatgcagctaattta
tataatttaaaaattattttaagagatataaatgatagtatcaatataactagatttatt
gttatatccaaaaaacttatagaagacggagataaaactatggtaatgtttactgtacct
cataaacctggtgcattatataaggtcttagagaaattttataacaataacattaatttg
acaatgatctactcaagaccattaaaaagtataccatggcaatattacttttacctggaa
tttgaaggaaatataaaagacaataaagtaaaagcaacattagaagaaattagaaatata
acatctatgttaaaaataaaaggtagttttactaaattacaataccaggtttcaaattat
ctaagctaa

DBGET integrated database retrieval system