KEGG   Sulfurisphaera tokodaii: STK_02970
Entry
STK_02970         CDS       T00062                                 
Symbol
radA
Name
(GenBank) DNA repair and recombination protein RadA
  KO
K04483  DNA repair protein RadA
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sto03400]
    STK_02970 (radA)
DNA repair and recombination proteins [BR:sto03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Archaeal homologous recombinant proteins
     STK_02970 (radA)
SSDB
Motif
Pfam: Rad51 RecA HHH_5 AAA_25 ATPase Cdd1 AAA_22 AAA_24 AAA_18 DUF6296
Other DBs
NCBI-ProteinID: BAB65267
UniProt: Q975Y1
Position
complement(316394..317368)
AA seq 324 aa
MNDMSSDGKKVKSLSDLPGVGQSILNKLIEAGYSSLEAVAVASPQDLSVAAGIPLTTAQR
IIKEAREALDIRFKTALEVKKERINTKKITTGSQALDGLLGGGIETRTMTELFGEFGSGK
TQLCHQLSVNVQLPLEKGGLGGKAVYIDTEGTFRWERIEAMSKAIGLEPDSAMNNIYYMR
AINSDHQMAIVDDLQELISKDPAIKLVIVDSVTSHFRAEFPGRENLAVRQQKLNKHLHQL
VRLAEMYDLAVIITNQVMARPDMFYGDPTVAVGGHTLYHVPGIRVQLKKSRGNKRIARIV
DAPHLPEGEVVFAITEEGVRDAEE
NT seq 975 nt   +upstreamnt  +downstreamnt
gtgaatgatatgtcttctgatgggaagaaagtaaaaagtctctcagatcttcctggagta
ggacagagtattcttaacaaacttattgaagctgggtattcgtcattagaagcagttgct
gtagcttctcctcaagatttgagtgtagctgcaggaataccactaactacagcccaaaga
ataattaaagaggcgagagaggctttagatataagatttaaaacagccttggaagtaaag
aaggagaggataaatactaagaaaataactactggtagtcaagctttagacggactttta
ggcggaggaatagagacaagaacaatgactgaactcttcggagagtttggctctggtaaa
actcaattatgccatcagttaagtgttaatgttcaattaccgttagaaaaaggcggatta
ggaggtaaagctgtttatatagatactgagggtacttttagatgggaaagaatagaagct
atgtcaaaggctatagggttagaaccagatagtgcaatgaataatatatattatatgaga
gcgattaacagtgatcatcaaatggcaatagttgatgatcttcaagaactcattagcaaa
gatccagcaattaaactagtaattgtagattctgtaacttcacactttagggctgaattc
cctgggagagaaaatttagctgtgagacagcaaaaattaaacaaacacttacatcaatta
gtaagattagcggaaatgtatgaccttgcggttataataacaaatcaagttatggcgagg
ccagatatgttttatggtgatcctacagtggctgtaggtggtcatactctatatcatgtt
ccaggtataagagttcagcttaagaaaagtagaggcaataaaagaatagctagaatagtt
gatgctcctcatttgccagaaggagaagtagtatttgcgattacggaagagggagtaaga
gacgctgaagagtaa

DBGET integrated database retrieval system