KEGG   Sulfurisphaera tokodaii: STK_02990
Entry
STK_02990         CDS       T00062                                 
Name
(GenBank) RNA (m5C) methyltransferase
  KO
K22901  tRNA (cytosine40_48-C5)-methyltransferase [EC:2.1.1.-]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sto03016]
    STK_02990
Transfer RNA biogenesis [BR:sto03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    STK_02990
SSDB
Motif
Pfam: Methyltr_RsmB-F Methyltr_RsmF_N Methyltransf_31 PCMT Methyltransf_4 Met_10 FtsJ Methyltransf_25 Fibrillarin TssC RrnaAD
Other DBs
NCBI-ProteinID: BAK54226
UniProt: F9VMT0
Position
complement(317915..318922)
AA seq 335 aa
MTIENYVKKYNNLFTISPSLKAISLASKYKFLSYMVERYIKIMGEEETEDFLYSCSFPLK
KSVRCNDLLIECNKLEKIMENKGFKLEKVSWLKHGYIVKQYPSKPSLGATIEYLSGYYYI
QGLASMVPPYVLDPNENDLVLDMAAAPGSKTTQLAQLMKNKGLIVAVEKSRERIKSLYSN
VNRMKIKNVVLLRADARILRKLNIPFNKILLDVPCSGEGLIPEDPSRKTKTTIEDLKIFF
QNQLELIDIAYNILEPGGILVYSSCSIAPEENEAVVNYIIENYGAKTDKIYGYPATSGIT
EFNGIKFDESLRNCIRFYPHKSGTEGFFVCKIIKE
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgacaattgaaaattatgttaaaaagtataataatttatttacaatctctcctagttta
aaggctatttccctcgcgtcgaaatataaatttctatcttatatggtagaacgatatata
aaaattatgggagaagaagaaacagaagattttttatatagttgttcctttcctttaaag
aaaagtgtaagatgtaatgatcttctaatagaatgcaataaactagaaaaaataatggaa
aataaaggatttaaactagaaaaagtttcatggttaaaacatggatatatagtaaaacag
tatccatctaagcctagtttaggtgcgacaatagaatatttatctggctactattatatt
caaggactagcatcgatggttcctccatacgtattagatccaaatgaaaatgatcttgtc
cttgatatggctgctgcaccggggagcaaaactacacaactagcacaattaatgaaaaat
aaaggattaatagttgccgtagaaaaatctagggaaagaattaaatctctttactcaaat
gtaaatagaatgaaaattaaaaatgttgttttacttagggcagacgcaagaatattgcgt
aaattaaatataccatttaataaaattctgttagatgttccgtgcagtggtgaaggtctt
ataccagaagatccttcaagaaaaactaaaactactatagaggatttaaaaatatttttt
caaaatcaactagaacttatagatattgcttataatatactagaaccaggaggcatatta
gtgtattctagctgtagtatagccccagaggagaacgaagctgttgtaaattatataata
gaaaattatggggcaaaaacagataaaatttatggttaccctgctactagcggaattact
gaatttaatgggattaaatttgacgaaagtttaagaaattgcataaggttttatcctcat
aaaagtggtacggagggattctttgtttgcaaaataataaaggagtaa

DBGET integrated database retrieval system