KEGG   Sulfurisphaera tokodaii: STK_03100
Entry
STK_03100         CDS       T00062                                 
Name
(GenBank) geranylgeranylglyceryl phosphate synthase
  KO
K17104  phosphoglycerol geranylgeranyltransferase [EC:2.5.1.41]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00564  Glycerophospholipid metabolism
sto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    STK_03100
Enzymes [BR:sto01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.41  phosphoglycerol geranylgeranyltransferase
     STK_03100
SSDB
Motif
Pfam: PcrB His_biosynth Ribul_P_3_epim IMPDH DpaA_N B12-binding
Other DBs
NCBI-ProteinID: BAK54230
UniProt: Q975W8
Position
325095..325829
AA seq 244 aa
MRKIIQEKLNEGKVLHFSLFDPDKVDLESIYSIALKLVESGTSGFLIGGTLGVSKEKLDS
IIEILEDFEVPKIIFPSNVNLITEKADAILFMSLLNSDDIYYITGAQLIAAPIIKKLKLE
SLPTGYIIVGHGGTAAHVGKARVIPYDNIELIVAYSIMAELFGMDFVYLEAGSGAPEPIR
PSVISITKKYLENSKIIVGGGIRNEEIAKELALAGADIIVTGNIIEQNLEKALKIVKEIS
NIRR
NT seq 735 nt   +upstreamnt  +downstreamnt
gtgaggaagataattcaggagaaactgaatgaaggaaaagttttgcatttttctttattc
gatcctgataaagtagatctagaatcaatttattcaatagcattaaagctagtagaatct
ggtacaagtggttttttaataggtggaactttaggagtatctaaagaaaaacttgacagt
ataatagagattcttgaagattttgaggtacctaaaataatttttcctagtaatgtcaat
ttaataactgaaaaagctgatgcaatactttttatgtctctcttaaattcagatgatatt
tattatataactggggctcaattaattgccgcacccataattaagaagcttaagttagaa
tcattacctacaggatatataattgttgggcatggaggaacagctgctcatgttggtaag
gctagagtaataccttatgataatattgaattaatagtcgcatattctatcatggctgaa
ctttttggaatggatttcgtttatttagaagcaggctcaggtgcaccagagcccataaga
ccttcagttatctctattactaagaaatacttagaaaattctaaaattatagtaggaggt
ggaattagaaatgaagagatagcaaaagaattagctcttgctggagcagatattatagta
actgggaatattattgagcagaatttggaaaaagcattaaaaatagtaaaagagattagt
aatattaggagataa

DBGET integrated database retrieval system