KEGG   Sulfurisphaera tokodaii: STK_03115
Entry
STK_03115         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: AsnC_trans_reg NapD GYD
Other DBs
NCBI-ProteinID: BAB65283
UniProt: Q975W5
Structure
Position
326870..327121
AA seq 83 aa
MASAIVLINTDAGGEDEVFERLKSMSEVTEVHVVYGVYDIVVKVEADSMDKLKDFVTNTI
RKLPKVRSTLTMIIVEGKSLVKK
NT seq 252 nt   +upstreamnt  +downstreamnt
atggcctctgcaatagtcctcataaatacagatgctggtggagaagacgaggtatttgaa
agattaaaaagtatgagtgaagtcacagaagttcatgtagtatatggagtttacgatata
gtagtgaaagttgaggcagattctatggataaattaaaagattttgtgacaaatacaata
agaaaattgcctaaggtgagatcaacattaacaatgataatagtagagggaaagagtctg
gtcaaaaaataa

DBGET integrated database retrieval system