KEGG   Sulfurisphaera tokodaii: STK_03210
Entry
STK_03210         CDS       T00062                                 
Name
(GenBank) rosettasome beta subunit
  KO
K22447  archaeal chaperonin
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sto03110]
    STK_03210
Chaperones and folding catalysts [BR:sto03110]
 Heat shock proteins
  HSP60 / Chaperonin
   STK_03210
SSDB
Motif
Pfam: Cpn60_TCP1 ACCA
Other DBs
NCBI-ProteinID: BAK54236
UniProt: O24735
Position
complement(341711..343369)
AA seq 552 aa
MSTTATVATTPEGIPVIILKEGSSRTYGKEALRINIAAVKAVEEALKSTYGPRGMDKMLV
DSLGDITITNDGATILDKMDLQHPAAKLLVQIAKGQDEETADGTKTAVILAGELVKKAEE
LLYKEIHPTIIVSGFKKAEEQALKTIEEIAQKVSVNDMDILKKVAMTSLNSKAVAGAREY
LADIVAKAVTQVAELRGDRWYVDLDNIQIVKKHGGSINDTQIIYGIVVDKEVVHPGMPKR
VENAKIALLDASLEVEKPELDAEIRINDPTQMKKFLEEEENLLKEKVDKIAATGANVVIC
QKGIDEVAQHYLAKKGILAVRRAKKSDLEKLARATGGRVVSNIDELTPQDLGYAALVEER
KVGEDKMVFVEGAKNPKAVSILIRGGLERVVDETERALRDALGTVADVIRDGRAVAGGGA
VELEIAKRLRKYAPQIGGKEQLAIEAYASALENLVMILIENGGYDPIDLLVKLRSAHENE
ANKWYGINVFTGQVEDMWKLGVIEPAVVKMNAIKAATEAATLILRIDDLIAAGKKSESKG
GESKSEEKKEED
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgtcaaccacagctacagttgcaactacacctgaaggtattccagttattatattaaaa
gaagggtcaagtagaacttatggcaaagaagcattaagaataaacatagccgctgtaaaa
gctgtagaagaagctctaaaaagtacttatggacctagaggaatggataaaatgttagtt
gatagtctgggtgatattactattacaaatgatggtgccacaatccttgacaaaatggac
ttacaacatccagcagctaaattattagtacaaatagccaaaggacaagatgaagagaca
gcagatggtacaaagactgcggtaattctcgcaggagaattagttaaaaaggcagaagaa
ctactatataaagagattcatccaactattatagtaagtggatttaagaaggcagaagaa
caagcattaaaaacaatagaagaaattgctcaaaaggtatctgtcaatgatatggatata
ttaaagaaagttgctatgacatcactaaatagtaaagcagtcgcaggtgcaagagaatac
cttgcagatatagtcgcaaaagcagtaacccaagttgcagaattaagaggagatagatgg
tacgttgatctagataatatacaaatagttaagaaacatggcggtagtattaatgataca
caaataatttatggaattgttgtcgataaagaagttgttcatcctggaatgcctaagaga
gtagaaaatgcaaaaattgcattgcttgatgcttccttagaggtagaaaagccagaatta
gatgcagaaatccgtataaatgaccctacacaaatgaagaaattccttgaggaagaagaa
aacttactgaaggaaaaagtagataagattgctgctactggtgctaatgtagtaatatgc
cagaaaggaattgatgaagtcgcacaacactatctggcaaagaaaggaattttggctgta
agaagagctaaaaagagtgacttagaaaaattagccagagctactggtggtagagtagta
tctaatattgatgaattaactccacaagatttaggatatgcagcactagtagaagaaaga
aaagtaggagaagataaaatggtatttgttgaaggagctaagaatcccaaagctgtaagt
atattaattagaggaggtttagaaagagtagttgatgagacagaaagagcattaagagat
gctctagggactgtagccgatgtaataagggatggtagagcagtagcaggtggtggagca
gtagaattggaaattgcaaaaagattaaggaaatatgcaccgcaaattggaggcaaagaa
cagttagctattgaagcttatgcgtcagcattagaaaaccttgtaatgatattaattgaa
aacggtggttatgatcctattgatctgttggtaaaactaagaagtgcccatgagaacgag
gcaaacaaatggtatggtattaatgtgtttactggccaagtagaagatatgtggaaactt
ggagtcatagagcccgcagtagtaaagatgaatgcaattaaagctgcaaccgaagctgca
acattaatattaagaattgatgatctaatagctgcaggaaagaagtcagaaagcaaaggc
ggagaatctaagagcgaagaaaagaaagaagaagattaa

DBGET integrated database retrieval system