KEGG   Sulfurisphaera tokodaii: STK_03340
Entry
STK_03340         CDS       T00062                                 
Symbol
tfe
Name
(GenBank) transcription factor E
  KO
K03136  transcription initiation factor TFIIE subunit alpha
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    STK_03340 (tfe)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sto03021]
    STK_03340 (tfe)
Transcription machinery [BR:sto03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     STK_03340 (tfe)
 Prokaryotic type
  Archaeal type
    TFE
     STK_03340 (tfe)
SSDB
Motif
Pfam: TFIIE_alpha WSLR DNA_ligase_ZBD HTH_9 HTH_11 TrmB Imm6 Zn_Tnp_IS1595 IF2_N zf-Mss51 zf-TFIIB TF_Zn_Ribbon LysW-like_globular zf-ribbon_3
Other DBs
NCBI-ProteinID: BAB65311
UniProt: Q975T8
Position
353161..353697
AA seq 178 aa
MSSRAEELILSLAKDLVGEDATELLKFLLRKRIEMTDDDIAKELNVKVNEIRKKLYLLSE
QGFITYRKTRDKETGLFIYYWKVNIDQINELLLNRKRLVLEKLKARYEQEKDSLYYYCPQ
DNIQYNFDEALENEFKCPKCGSPLEYYDSEKTKKFLEYKIKQIENEIERETRHGSNSR
NT seq 537 nt   +upstreamnt  +downstreamnt
atgagtagtagggcagaagaattgatacttagcttggcaaaggatctagttggtgaagat
gcaacagaattattaaagtttctcttaagaaagagaattgaaatgacagatgatgatata
gcgaaagagcttaatgtaaaagtgaacgaaattaggaaaaagttatatttactttctgag
caaggttttataacctatcgtaaaacaagagataaagaaacgggtttatttatatattac
tggaaagtaaacatagatcagataaatgaattattacttaacagaaaaagattagtacta
gaaaaattaaaggcgagatatgagcaagagaaagattctttatattattattgtcctcaa
gataatattcaatataattttgatgaagcattagagaatgaattcaaatgtccaaaatgt
ggatcaccactagaatattacgactcagaaaagactaaaaaattcttagagtataagata
aaacaaattgaaaacgaaatagaaagagagacacgacatggctccaatagtcgttga

DBGET integrated database retrieval system