KEGG   Sulfurisphaera tokodaii: STK_03420
Entry
STK_03420         CDS       T00062                                 
Symbol
ahcY
Name
(GenBank) adenosylhomocysteinase
  KO
K01251  adenosylhomocysteinase [EC:3.13.2.1]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00270  Cysteine and methionine metabolism
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    STK_03420 (ahcY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sto01009]
    STK_03420 (ahcY)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sto04147]
    STK_03420 (ahcY)
Enzymes [BR:sto01000]
 3. Hydrolases
  3.13  Acting on carbon-sulfur bonds
   3.13.2  Thioether and trialkylsulfonium hydrolases
    3.13.2.1  adenosylhomocysteinase
     STK_03420 (ahcY)
Protein phosphatases and associated proteins [BR:sto01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STK_03420 (ahcY)
Exosome [BR:sto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STK_03420 (ahcY)
SSDB
Motif
Pfam: AdoHcyase AdoHcyase_NAD 2-Hacid_dh_C IlvN TrkA_N Oxidored_nitro THF_DHG_CYH_C Peptidase_M35 3HCDH_N
Other DBs
NCBI-ProteinID: BAK54243
UniProt: Q975T0
Position
359720..360967
AA seq 415 aa
MDYKVKDLSLAEQGKKQIEWAEIHMPALMEIRKQFEKEKPLQGLRISAVLHVTKETAVLV
KTLKIGGATVALAGSNPLSTQDDVAAALVEEGIRVFAWRGETEKDYYDNIKEILKYEPQI
IMDDGGDLHAYVHENMPQLKLFGGTEETTTGVIRLKAMEEQGVLRYPVIAVNNAFTKYLF
DNRIGTGQSTIDGILRATNILIAGKVAVVAGYGWVGRGIAQRLRGMGARVIVVEVSPLRA
LEAVMDGFDVMPMSKAAELGEIFITATGNINVIRKEHILKMKDGAILANSGHFNVEIDVK
GLKEMAKSSRLIRPNLEEYELPNGKRIYLLAEGRLVNLAAAEGHPSEVMDLSFSNQALSV
KYIYENRGKLENKVYNVPQEIDETVAKLKLNGMGIEIEPMTQEQIEYMKQWRYGT
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggactataaggttaaagatcttagtttagctgaacaaggtaaaaaacaaatagaatgg
gcagaaatacacatgccagcattaatggagataagaaagcaatttgagaaagaaaaacct
cttcaaggattaaggattagtgctgtccttcacgtaactaaggaaactgctgtattagtt
aagactctaaaaataggaggagctacagttgcattagctggtagtaatccgttatctact
caagatgacgttgctgctgcactagttgaggagggaattcgtgtatttgcatggagaggt
gaaactgaaaaagattattatgataatattaaagaaattctaaaatatgaacctcaaata
ataatggatgatggaggagatcttcatgcttatgtccacgaaaatatgccacagttaaaa
ctatttgggggtacagaagaaacaacaacaggagtaataagactaaaggccatggaagaa
caaggagtcctaagatatccagtaatcgctgtaaataatgcttttacaaaatacttattt
gataatagaataggtactggacagagtacaatagatggaatacttagagcaacaaatata
ctaattgctggtaaagtagctgtagtagctggatacggatgggtaggaagagggatagct
caaaggcttagaggtatgggtgctagggttatagtggtcgaagtatctcctttaagagca
ttagaggcagttatggatggttttgatgtaatgccaatgagtaaagctgcagaattaggg
gagatttttatcactgctaccggtaatataaacgtaataagaaaagaacatattctaaaa
atgaaagatggtgcaattttagcaaactctgggcattttaatgtagagatagacgtaaaa
ggattaaaagaaatggcaaaatcatcaagattgataagaccaaacttggaagaatatgaa
ttacctaatggaaaaagaatttatttattagctgaaggtagattagttaatttagctgca
gccgagggacatcctagtgaggttatggatttaagcttttcaaatcaagctttatcggta
aagtatatttatgaaaatagaggaaagttagagaataaagtatataatgttccacaagag
atagatgaaacggttgctaaattaaaattaaatggaatgggaatagaaatagagccaatg
acacaagaacaaatagaatacatgaaacaatggagatatggtacttga

DBGET integrated database retrieval system