KEGG   Sulfurisphaera tokodaii: STK_03490
Entry
STK_03490         CDS       T00062                                 
Symbol
tfb1
Name
(GenBank) transcription initiation factor IIB 1
  KO
K03124  transcription initiation factor TFIIB
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    STK_03490 (tfb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sto03021]
    STK_03490 (tfb1)
Transcription machinery [BR:sto03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     STK_03490 (tfb1)
 Prokaryotic type
  Archaeal type
    TFB
     STK_03490 (tfb1)
SSDB
Motif
Pfam: TFIIB TF_Zn_Ribbon HTH_AsnC-type Sigma70_r4 Cyclin_C HTH_24 HTH_Tnp_ISL3 HTH_11 Sigma70_r4_2 HTH_Crp_2 HTH_23 HTH_36 RB_B
Other DBs
NCBI-ProteinID: BAB65329
UniProt: Q975S1
Position
371631..372557
AA seq 308 aa
MSESNKSQASATPCPPDKIVFDEERGEYICTETGEVIEERAIDQGPEWRAFTPEEKEKRS
RVGGPLNQTIHDMGISTVIDWKDKDAMGRTLDPKRRLEVLRWRKWQIRARIQSSIDRNLA
QAMNELERIGNLLNLPKAVKDEAALIYRKAVEKGLVRGRSIESVVAASIYAACRRMKMAR
TLDEIAQFTKANRKEVARCYRLILRELDINVPVSDPKDYVTRIGSLLGLSGSTMKMAIDI
IEKAKESGLTAGKDPAGLAAAAIYIAALLNDERRTQKEIAQIAGVTEVTVRNRYKELTQE
LKIQIPNQ
NT seq 927 nt   +upstreamnt  +downstreamnt
atgtcagaaagtaataaatctcaagcttctgctactccttgtcctccagataaaatagtt
tttgatgaggaaaggggagagtatatttgtacggaaactggggaagtgatagaagaaagg
gcaattgatcaggggcccgaatggagggctttcactccagaagaaaaagagaaaagaagt
agagttggaggtccattaaatcagactatacatgatatgggtatatctactgtaattgat
tggaaagacaaagacgcaatgggtagaactttagatccaaagaggagattagaagtatta
agatggagaaagtggcaaattagagcaagaatacaatcttctatagatagaaacttagca
caagcaatgaatgagttagagagaataggaaacttgcttaatttaccaaaggctgtaaaa
gatgaggctgctttaatttatagaaaagctgttgagaaaggattagtaagaggcagaagt
attgaaagtgttgttgcagcatctatatatgcagcttgtagaagaatgaagatggcaagg
acattagatgaaattgctcaatttacaaaggctaacagaaaagaagtagctagatgttat
agattaattttaagagaattagatattaatgtccctgttagtgatccaaaggattatgtt
actagaattggtagtttgttaggcttaagcggttctacaatgaagatggcaatagatatt
attgagaaagctaaagagtctggtctaacggctggaaaagatcctgctggcctggcagct
gctgcaatttatatagcggccttacttaatgatgaaagaaggacgcagaaagagattgca
cagattgcaggtgttacagaagtaactgttagaaatagatataaggaattaacacaagag
ttaaaaattcaaattccaaatcaataa

DBGET integrated database retrieval system