KEGG   Sulfurisphaera tokodaii: STK_03520
Entry
STK_03520         CDS       T00062                                 
Symbol
speB
Name
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00330  Arginine and proline metabolism
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    STK_03520 (speB)
Enzymes [BR:sto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     STK_03520 (speB)
SSDB
Motif
Pfam: Arginase DTX3L_a-b APS_kinase
Other DBs
NCBI-ProteinID: BAB65332
UniProt: Q975R8
Position
complement(373125..374012)
AA seq 295 aa
MSDSRLLYLNENSRLFAGFNKPTSPFVIIGLPLDITSSFRPGSRFAPSTIREYAQFIEFY
SIRTGIDMGEVGFNDVGDVVMHPSDVEENIRRISDVTSYFAEKGKIIIGIGGEHSVTVGT
VRGIKPDCVLSIDAHLDLRDEYMGYKYDHACVMRRISEQGVKIMEIATRAVSKEELDYAN
KNGIAYLTPHQIRLLGVRETAKKIVNNFRDCEKIYVTYDMDGIDPAYAPGVATPEPEGLD
PTTVLDIISLIIDKRVVGFDVVEVSPPHDPSGITSVLGARIILETSAQIYKARSL
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtcagatagcaggttactatacttaaatgaaaatagtagattatttgccggatttaat
aaaccaacatctccatttgttataattggtctaccattagatataacaagtagtttcaga
ccaggttccagatttgcaccatctaccataagagagtacgcacaatttattgagttttat
tctataagaactggaatagatatgggagaagtagggtttaatgatgtaggagatgtagta
atgcatccctctgatgtagaagaaaatataagaagaatatcagacgtaactagttatttt
gccgaaaaaggaaaaataataataggtataggtggagaacattctgtaactgtaggaact
gtaagaggaattaaaccagactgtgtacttagtattgacgcacatctagaccttagagat
gaatacatgggttataaatacgaccacgcttgtgttatgagacgaatatcagaacaggga
gttaaaataatggaaatagctacaagagctgtctctaaagaagaattagattacgcaaat
aaaaacggaatagcttatcttacaccacatcaaataagattattaggagtaagagagact
gcaaagaaaattgttaacaatttcagagattgtgaaaaaatctatgtaacatatgatatg
gatggaatagatccagcatatgctccaggtgtagctactccagagcctgaaggattagac
ccaactacagtactagatattatatcgcttataatagataaaagagttgtaggctttgat
gtagtagaagtttcaccacctcatgatccatctggaataacttcagtattaggagccaga
ataatcttagaaacatctgcccagatttataaggctagatcgctttaa

DBGET integrated database retrieval system