KEGG   Sulfurisphaera tokodaii: STK_03640
Entry
STK_03640         CDS       T00062                                 
Name
(GenBank) serine/threonine-protein kinase
  KO
K08851  TP53 regulating kinase and related kinases [EC:2.7.11.1]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sto01001]
    STK_03640
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sto03016]
    STK_03640
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     STK_03640
Protein kinases [BR:sto01001]
 Serine/threonine kinases: Other
  Bud32 family
   STK_03640
Transfer RNA biogenesis [BR:sto03016]
 Eukaryotic type
  tRNA modification factors
   KEOPS/EKC complex
    STK_03640
 Prokaryotic type
    STK_03640
SSDB
Motif
Pfam: RIO1 Pkinase ABC1 Kdo APH PK_Tyr_Ser-Thr EcKL Choline_kinase Kinase-like
Other DBs
NCBI-ProteinID: BAK54251
UniProt: F9VMV4
Position
381314..381970
AA seq 218 aa
MEIIRELKRGAESIIYEGYFAGIHAVFKKRISKSYRDQKLDYKINSERTKLEARLMYSAL
KNGINVPALLLVDPYEYLIVMEYIDGFPVKEIVPKYKDDNLIRIGEMIGEIAGKLHKSGI
SHGDFTTNNLIYTTDNEIFLIDFGLSKRSDDIEDFATDVHVFLRSLESVHYEFKDIIFKG
FEKGYSKFMDFKSIMNTVKQIRMRGRYVEERRSKRNNV
NT seq 657 nt   +upstreamnt  +downstreamnt
atggagattatcagagaattaaagagaggagcagagtccataatttatgaaggatatttt
gcgggtattcacgctgtatttaagaaaagaatatctaaatcttatagagatcaaaaactt
gattataaaattaatagtgaaaggactaaattggaagctagattaatgtattcagcttta
aaaaatggtatcaatgttccagcattattacttgttgatccttatgaatacttaattgtc
atggaatatatagacggatttcctgtgaaagaaatagttcctaagtataaagatgataat
ttaatccgaattggtgaaatgataggggaaattgctggaaaactgcataaatctggaata
tcacatggagatttcactacaaataatcttatatacactactgataatgagatattttta
atagattttggactatctaagagaagcgatgatattgaagatttcgcaacagatgtgcat
gtttttttaaggagtttagaaagtgttcattatgaatttaaagatataattttcaaaggt
tttgaaaaaggctattctaaatttatggattttaagagtattatgaatacagtgaaacaa
ataagaatgaggggaagatatgttgaagagcgtagaagtaaacgtaataacgtctaa

DBGET integrated database retrieval system