KEGG   Sulfurisphaera tokodaii: STK_03710
Entry
STK_03710         CDS       T00062                                 
Name
(GenBank) putative TrmB family transcriptional regulator
  KO
K23356  HTH-type transcriptional regulator, sugar sensing transcriptional regulator
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sto03000]
    STK_03710
Transcription factors [BR:sto03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    STK_03710
SSDB
Motif
Pfam: TrmB MarR HTH_24 PadR HTH_27 HTH_11 Rrf2 HTH_IclR MarR_2 HTH_Crp_2 HTH_CodY Cytokin_check_N HTH_34 AbiEi_4 DUF4980 Penicillinase_R
Other DBs
NCBI-ProteinID: BAK54254
UniProt: F9VMV7
Position
complement(386183..386923)
AA seq 246 aa
MSQNIDDIVSKIGNIARAFGITRNELKLYFLLLLNGKMTAKELSDKINISYTKIYPILTK
LEGRGWIRRIGKRPSYYVANPIREVWENVKKNISDALEKVERELILPISVLLSSQTSFYN
IALVQQDNIAQTLKQILAENSSKYYVAISFKELISDDLIKILEANSYKYDVRVILTKNIN
IESNVLNIKYLDSMFGSGIITSNSIFLIIKTQGNMLLGMFSNHIYFVEIGKVYFEYLWEK
ADKSKE
NT seq 741 nt   +upstreamnt  +downstreamnt
atgtctcagaacatagatgatatagttagtaaaattggaaatatagcaagagccttcgga
ataacccgaaatgaattgaaactctattttttattattacttaatggaaaaatgactgct
aaagaattatccgataaaataaatatttcctatactaaaatttatccaattttaacaaaa
cttgaaggaaggggatggattagaagaataggaaagagaccatcatattatgtagctaat
ccaataagagaggtatgggagaatgttaaaaagaatatttctgatgcattagagaaagta
gaaagagaattaatcctacctatttctgtattgctttcttctcaaacatcattctataac
atagcattagtacaacaagataatattgcacagactttaaagcaaatattagctgaaaac
tcaagtaaatactatgttgctatatcttttaaagaactaatttcagatgatttaattaaa
attttagaagcaaattcatataaatatgatgtaagagttatattaacaaaaaatattaat
atagagagtaatgttcttaacataaaatatttagactcaatgtttggaagcggtattata
acttctaactctatatttttaataataaaaactcaaggaaatatgttactaggtatgttc
tcaaatcatatttatttcgtagaaataggtaaagtttattttgagtatttatgggaaaag
gctgataaaagtaaggaataa

DBGET integrated database retrieval system