KEGG   Sulfurisphaera tokodaii: STK_03785
Entry
STK_03785         CDS       T00062                                 
Symbol
spt4
Name
(GenBank) transcription elongation factor Spt4
  KO
K15171  transcription elongation factor SPT4
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    STK_03785 (spt4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sto03021]
    STK_03785 (spt4)
   03019 Messenger RNA biogenesis [BR:sto03019]
    STK_03785 (spt4)
Transcription machinery [BR:sto03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     STK_03785 (spt4)
  RNA polymerase I system
     STK_03785 (spt4)
Messenger RNA biogenesis [BR:sto03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    DRB sensitivity inducing factor (DSIF) complex
     STK_03785 (spt4)
SSDB
Motif
Pfam: Spt4 zinc_ribbon_2 DZR_2 UPF0547 zinc_ribbon_15 DZR zf-RRN7 RecR_ZnF zf-C3HC4_3 DUF6083 NRDD HypA zf-C4H2
Other DBs
NCBI-ProteinID: BAB65359
UniProt: Q975P1
Position
complement(395993..396196)
AA seq 67 aa
MPGKNKEFKACKNCRALVPQDTPKCPVCGSISFSDDWSGIVIILDPESETAKLFGATVPW
RYAIIVK
NT seq 204 nt   +upstreamnt  +downstreamnt
atgcccggaaaaaataaagaatttaaagcttgtaagaattgcagagcattagtaccacaa
gatacacctaaatgcccagtttgtggatcaattagcttcagcgatgattggagcggaatt
gtaatcattttggatcctgagtcagaaacagcaaaattatttggggctactgtaccttgg
agatacgcaataatagtgaaatag

DBGET integrated database retrieval system