KEGG   Sulfurisphaera tokodaii: STK_03810
Entry
STK_03810         CDS       T00062                                 
Symbol
aif2g
Name
(GenBank) translation initiation factor 2 gamma subunit
  KO
K03242  translation initiation factor 2 subunit 3
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sto03012]
    STK_03810 (aif2g)
Translation factors [BR:sto03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    STK_03810 (aif2g)
SSDB
Motif
Pfam: GTP_EFTU eIF2_C GTP_EFTU_D2 RsgA_GTPase PduV-EutP MMR_HSR1_Xtn MMR_HSR1 MeaB DO-GTPase2
Other DBs
NCBI-ProteinID: BAK54258
UniProt: Q975N8
Position
complement(397154..398410)
AA seq 418 aa
MSWPQVQPEVNIGVVGHVDHGKTTLVQAITGVWTSKHSEELKRGMTIKLGYAEASIGVCP
NCNKPEAYVTEYSCNQCGSDEKPQFLRKVSFIDAPGHEILMATMLSGAALMDGALLVVAA
NEPFPQPQTREHFVALGIVNIKNLIIVQNKVDVVSKEEALKQYKQIKEFLKGTWAEDAPI
IPVSALHKINIDALIEGIQKYIPTPQRDLSKDPIMLVIRSFDVNKPGTPYNELKGGVIGG
SIIQGKLEIGDEIKILPGLRHEKPGGKVEYEPLYTTITSIRFSDLEVKEAKPGGLVALGT
ELDPSYVKADSLVGSVVVKSSNKNVSVLWNLKIENYQLLERVVGAKELVKVENIKKGEVL
MLTLGSATTLGVAKNIKNDELEVELKRPLVVWDKDLRVVISRQVSGRWRLVGWGIIKI
NT seq 1257 nt   +upstreamnt  +downstreamnt
ttgtcttggccacaagttcaaccagaagttaacataggtgtagttggccatgtagatcat
ggtaaaactacattagtccaagcgattactggagtttggacttcaaagcatagtgaagaa
ttaaagagaggtatgacgataaaacttggatatgcagaagctagtataggtgtatgcccc
aactgtaacaagccagaagcatatgttacagaatactcttgcaatcagtgtggaagtgac
gaaaaaccacaatttcttaggaaagtatcttttattgatgcaccagggcacgaaatttta
atggctacaatgttatctggagcagcacttatggatggcgcgttacttgttgtagcagct
aatgaaccttttcctcaaccacaaacaagagagcattttgttgctttaggcattgttaat
ataaaaaatttaattatagtacaaaataaggtagacgtagtaagcaaagaagaagcgtta
aaacagtataagcaaataaaagaatttctaaagggtacctgggctgaagacgctccaata
attccagtcagtgcgttgcataaaattaatatcgatgcgttaatagaaggaattcaaaag
tatatcccaactcctcagagagatcttagcaaagatccaatcatgttagttattagaagt
tttgatgtaaataagcctgggactccttataatgaactgaaaggaggagtaattggaggt
agtattattcaaggaaaactagaaataggagacgagataaaaatcttaccaggattaagg
catgaaaaacctggcggtaaagtagagtatgaaccgctttacacaacaattacttctatt
cgcttttctgatttagaagtaaaagaggctaaaccgggtggtttagtagctttaggaact
gaattagatccttcctatgttaaggctgatagtttagttggtagtgtagtagttaaatcg
agtaacaaaaatgtttctgttttatggaatttaaaaattgaaaactatcaattactagaa
agagttgttggagcaaaagaattagttaaggtcgagaatattaagaaaggcgaggtactg
atgttaacattaggttcagcaactaccttaggtgtagcaaaaaacattaagaatgacgaa
ttagaagtagaattaaaaaggcctttagtagtatgggataaagatttaagagttgttata
agtagacaagttagtggaagatggagactagtaggttggggaataataaaaatttag

DBGET integrated database retrieval system