KEGG   Sulfurisphaera tokodaii: STK_03970
Entry
STK_03970         CDS       T00062                                 
Symbol
pcnB
Name
(GenBank) DNA polymerase sliding clamp B
  KO
K04802  proliferating cell nuclear antigen
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03030  DNA replication
sto03410  Base excision repair
sto03420  Nucleotide excision repair
sto03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    STK_03970 (pcnB)
   03410 Base excision repair
    STK_03970 (pcnB)
   03420 Nucleotide excision repair
    STK_03970 (pcnB)
   03430 Mismatch repair
    STK_03970 (pcnB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sto03032]
    STK_03970 (pcnB)
   03400 DNA repair and recombination proteins [BR:sto03400]
    STK_03970 (pcnB)
DNA replication proteins [BR:sto03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    STK_03970 (pcnB)
DNA repair and recombination proteins [BR:sto03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     STK_03970 (pcnB)
   MMR (mismatch excision repair)
    Other MMR factors
     STK_03970 (pcnB)
  TLS (translesion DNA synthesis) factors
   Other TLS factors
    STK_03970 (pcnB)
SSDB
Motif
Pfam: PCNA_C PCNA_N Rad1 Hus1 pNTSase1
Other DBs
NCBI-ProteinID: BAK54265
UniProt: Q975M2
Structure
Position
complement(408640..409386)
AA seq 248 aa
MIKATYSSAKDFYSLLSGLLKVTDEIILNFTEDSIFSRYLTDDKVLMVIFKIPKEYLEDY
TIDKPLGIKININDLKKILGKAKSKSATVTLEETEAGLKVTVRDEKTGTRSNIYIKGEKT
SIDQLTEPKVNLSVTFTTDGDVLKDIARDLSLVGEEVEISADENTVTLSTEEAGRTYKSL
LKQDKPLKSLNVESPSKAVYSIEVLKDVFKVTSISQNVTVGFGNNIPMKIEVPTDSGGQL
IFWIAPRL
NT seq 747 nt   +upstreamnt  +downstreamnt
atgattaaggctacatattcaagtgcgaaagatttttactccttgttatctggtctgctt
aaggttacagatgaaataattttaaactttactgaagacagtattttttcaagatatctg
acagatgataaagtactcatggttatatttaaaattccaaaagaatacctagaagattat
acgattgacaaaccacttggaattaaaattaatataaatgatttgaagaaaattcttgga
aaggctaaatctaaaagtgcaacagttactttagaagagactgaggctggcctaaaagtt
actgttagagatgagaaaacagggactagaagcaatatctatataaaaggagaaaaaact
tcaatagaccaattaacagaacctaaggtaaacctaagtgttacatttacaactgatgga
gatgtattaaaggatattgctagagatttaagcttagtaggtgaagaggttgaaatatct
gcagatgaaaacactgttaccctctccacagaagaggctggtagaacatacaagtctttg
ctaaaacaagataagcccctcaaatccttaaatgtagaatctccatcgaaagcagtatat
agcatagaagttctaaaagatgtatttaaagtaacttctatatctcaaaatgtaactgta
ggatttggaaataacatacctatgaaaattgaagtacctacagattctggtggtcaactt
atattctggatagcaccaagactatag

DBGET integrated database retrieval system