KEGG   Sulfurisphaera tokodaii: STK_04310
Entry
STK_04310         CDS       T00062                                 
Symbol
ileS
Name
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    STK_04310 (ileS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sto01007]
    STK_04310 (ileS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sto03016]
    STK_04310 (ileS)
Enzymes [BR:sto01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     STK_04310 (ileS)
Amino acid related enzymes [BR:sto01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   STK_04310 (ileS)
Transfer RNA biogenesis [BR:sto03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    STK_04310 (ileS)
 Prokaryotic type
   Other AARSs
    STK_04310 (ileS)
SSDB
Motif
Pfam: tRNA-synt_1 Anticodon_1 DUF5915 tRNA-synt_1g tRNA-synt_1_2 Rpr2 DUF6487 Nse4-Nse3_bdg APG12 NID
Other DBs
NCBI-ProteinID: BAK54280
UniProt: Q975H9
Position
complement(436977..440120)
AA seq 1047 aa
MPSKFDPLSTEKEILKFWEQNKIYEKLKEYNSKFEKKFLFIDGPPYPSSPIPHIGTVWNK
VIKDCILRYERLAGFRTYDQPGYDTHGLPIEVAIEKQLGIQKKSDIIEKIGVDNFVNKCK
EFALNNASSLTANFKNIGIFMDWNNPYMTLHNDYISNSWMLIKKAYERGLLYKGVHVLHW
CPRCETTLADYEVSEYKEIEDPSIYVKFKVKGSENRYLVIWTTTPWTLPANVFVMINKDY
EYAEVEVNNEILIMAKDRVSDVMKEAGIKNYKIVRTFKGVELVGLQYIHPLADIVTAQKG
LDNYHIVVDAGEEVTLTEGTGLVHSAPGHGDIDFEIGKKIGAPVVMLVNDRGEFLPEAGK
YVGKNVRSAAEEIINDLKQRNALLHSGKVVHRYPVCWRCKTPLILRAIEQWFIGVSKLKE
ELLKEIDNVKWVPDWGKTRIGNMVREIRDWVISRQRFWGTPLPIWICKNCGNIIVIGSRD
ELEKVAITKVPEDLHRPWIDKVVVRCNKCGGEAHRVPDVADVWFDSGVAFFASLGKDWEK
KWKEIGPVDLVLEGHDQLRGWFFSLLRAGVILLDRAPYNAVLVHGFMLDEQGREMHKSLG
NYVEPSQVTENEKYGRDVLRLWLLRNTTWEDAKFSWKALDQTKRDLNIIWNVYVFASTYM
NLDNFDPRIYNLDNLKQYLRIEDLWLLSRYNRVVKEVKESMNDFKVHELANKMTSFIIDD
ISRFYLRLVRKRAWNESNDPDKIAMYYVLYEVLKGSLVLLSPVIPFTTERIYQDFVVDKK
DSVSMESLPEVKEEFINDKIEKEFELSKEIAEAGLNARAKAGIKLRWPIKNAYVFLVSDI
DVEMANNVKEVIKFLLNTKDVEIGGIEGYRRFSKIKATPNRGTIGPDFKRLTNKIVEYIE
NNSEKVASDIIAKGYHEVVIEGEPVQIKVNHVNILEETEEGYISARFNKGVVVLKKEISK
EEEEEGIVRDIIRRIQFMRKQLNVQINDYILLYIKAPEERTEMLKKWTDYIKSETRAKEV
IIGEVKGDLILPWEIEDEEYIIGVSKS
NT seq 3144 nt   +upstreamnt  +downstreamnt
ttgccatctaaatttgatcctctttctacagaaaaagaaatattaaagttttgggagcaa
aataaaatctatgaaaaattaaaagaatataacagtaaatttgagaaaaaattcctattt
atagatgggccaccttatccttcaagcccaatcccacatataggaaccgtttggaataag
gtaataaaggattgtatactaagatatgaaaggttagcaggatttaggacctatgatcag
cctggttatgatactcatggtttgcctatagaagttgcaatagaaaaacaacttggaata
caaaagaaatcggatataatagaaaaaataggagttgataattttgttaataagtgtaag
gaatttgcattaaataacgcatcttctttgactgcaaactttaagaacataggaattttt
atggactggaacaacccctatatgacattacataatgactatatttctaactcttggatg
ctaatcaagaaagcatatgaaagaggattattatataaaggagtacatgttttacattgg
tgccctagatgcgaaacaacattagctgattatgaggtttcagaatataaagaaattgaa
gacccatcaatttatgtgaaatttaaagtaaaaggctcagaaaataggtatttagttatt
tggactacaacaccatggactttaccggcaaatgtctttgttatgattaataaagattat
gagtatgctgaagtcgaggtcaataatgagatactaattatggcaaaagatagagtaagt
gatgttatgaaagaagcaggaattaaaaactataagatagtaaggacatttaaaggagtg
gaattagttggattacaatatatacaccctttggcagatatagtcacagctcagaaaggg
cttgacaattatcatatagtcgttgatgctggagaagaagtaacgttaactgagggaacg
ggtcttgttcattctgctccaggtcatggtgatattgactttgaaataggcaaaaaaatt
ggagcaccagtagttatgttagttaatgatagaggtgaattcttaccagaagctggaaaa
tatgttggaaaaaatgtacgaagtgccgctgaagaaattattaatgacttaaaacagaga
aatgccttactgcattctggcaaggttgtccatagatatcctgtatgttggagatgtaaa
acacctctaattttgagggctatagagcaatggtttataggagtatctaaactaaaagag
gaattgttaaaagagattgacaatgttaaatgggtacctgactggggtaagacaagaata
ggaaatatggtaagagagattagggattgggtaattagcagacagagattttggggaaca
ccattaccaatatggatatgtaagaattgtggaaacataattgttataggaagtagagat
gagttagaaaaagtagcaataacaaaagtaccagaggatttacatagaccatggatagat
aaagtagttgtccgatgtaataaatgtggaggagaagctcatagagttccagatgtggct
gatgtgtggtttgatagtggggtagctttcttcgctagcctaggtaaagattgggaaaaa
aagtggaaagaaataggtcccgttgatttagtattagagggacacgatcaattacgagga
tggttctttagcctactaagggctggtgttatattattagatagagcaccatataatgca
gttctagtccatgggtttatgttagatgaacaaggtagagaaatgcataagagtcttgga
aattatgtagagccatctcaagtaactgaaaatgaaaaatatggtagagatgtcttgaga
ttatggttactcagaaatacaacatgggaagatgcaaagttctcttggaaagcacttgat
caaacaaaaagagatttaaacattatatggaatgtgtatgttttcgcatcaacatatatg
aacttagacaacttcgatccaagaatatataacctagacaacttaaaacaatacctgagg
atagaagatttatggttattatctagatataatagagttgtaaaagaagtaaaggaaagc
atgaacgatttcaaagtccatgagttagcaaataaaatgacaagtttcatcatagatgat
ataagtaggttctatctaagattagtcagaaaaagagcttggaacgaaagtaatgaccca
gataagatagcaatgtattatgtactttatgaagttctcaagggatcactagtactttta
tccccggtaattccgtttactactgaacgaatataccaggattttgtagtagataagaag
gattctgttagcatggaaagcttaccagaagtaaaagaagaattcataaatgataaaatt
gagaaagaatttgaactaagcaaagagattgcagaagctggattaaatgctagagccaag
gctggaattaaattaagatggccaataaagaacgcatatgtatttctagtctcggatata
gacgttgaaatggccaataatgtaaaagaagtaataaagttcttattaaatactaaagac
gtagaaattggaggaatagaaggctatagaaggtttagtaaaattaaggccacaccaaac
agaggtacaattggacccgatttcaaaaggcttactaacaaaatagtagaatatatagaa
aataactcagaaaaagtagcttcggatattatagctaaaggttaccatgaagttgtaata
gaaggagaaccagttcaaatcaaggttaatcatgttaatatactagaagaaactgaagaa
ggttacatatctgctaggtttaacaagggagtagtagttctaaagaaagaaataagtaaa
gaagaggaagaagaaggaatagttagagatattataagaagaatccagtttatgagaaag
caacttaatgtgcaaattaatgattatattctgttgtatataaaagcaccagaggaaaga
acagaaatgttaaagaaatggactgattacatcaaatcagagactagggctaaagaagtt
attataggagaagtaaaaggagacctaatattaccatgggaaatagaggatgaagaatat
attattggtgtaagtaaatcttga

DBGET integrated database retrieval system