KEGG   Sulfurisphaera tokodaii: STK_04360
Entry
STK_04360         CDS       T00062                                 

Definition
(GenBank) putative hydrolase
  KO
K07025  putative hydrolase of the HAD superfamily
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    STK_04360
SSDB
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like IFT81_CH HAD PGP_phosphatase Hydrolase_6
Other DBs
NCBI-ProteinID: BAB65425
UniProt: Q975H6
Position
complement(443143..443868)
AA seq 241 aa
MEEFNIFKDVKAIFFDFDNTLVSFDNLSNQALLKVADDILDYIRENYPNVNVDRDELSKT
LIEIAKKLDEEGVYDRRLWWEEVLKKYSVKAEMEDLYEWTQIYWSIAGNNTPYEDSLDAI
EYLKRKGFKLGIITNSDGEWGNKKQRINRFPLVSYFDIITISGENNIKPKPNVQPFILSC
EKLNLSVNQCLMVGDDPIKDCLAAKKAGLYSILVDREGKVKFAELYADFVIQNLKQLEEI
F
NT seq 726 nt   +upstreamnt  +downstreamnt
atggaagagttcaacatatttaaggatgttaaggctatattttttgactttgataacact
ttagtttcttttgataacctttctaatcaagctttacttaaggtggcagatgatatattg
gattacattagagaaaattatcctaatgtaaatgtagatcgtgatgagctctcaaagacg
cttatagaaatagcgaaaaaactagatgaagaaggggtttatgacagaagactatggtgg
gaggaagtattaaagaaatatagtgtaaaggcagagatggaagatttatacgagtggact
caaatatactggagtatagctggaaacaatacaccttatgaagatagcttggatgcaata
gaatatttaaaaagaaagggattcaaattaggtataataactaatagtgacggagaatgg
ggtaataaaaaacagagaatcaacagatttccattagtatcatattttgatataatcact
ataagtggtgaaaacaacataaaacctaaacctaatgtgcaaccatttatattatcttgt
gaaaaactcaatctctcagtaaaccagtgtcttatggttggagatgatccaattaaagat
tgcttagctgccaagaaggctggtttatattccatattggttgatagagaaggaaaagtc
aaattcgcagaactttatgcggattttgtaattcaaaatctaaaacagttagaagagatt
ttttag

DBGET integrated database retrieval system