KEGG   Sulfurisphaera tokodaii: STK_04520
Entry
STK_04520         CDS       T00062                                 

Definition
(GenBank) dual sugar-1-phosphate nucleotidylyltransferase
  KO
K23144  UDP-N-acetylglucosamine diphosphorylase / glucose-1-phosphate thymidylyltransferase / UDP-N-acetylgalactosamine diphosphorylase / glucosamine-1-phosphate N-acetyltransferase / galactosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.7.7.24 2.7.7.83 2.3.1.157 2.3.1.276]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00521  Streptomycin biosynthesis
sto00523  Polyketide sugar unit biosynthesis
sto00525  Acarbose and validamycin biosynthesis
sto01100  Metabolic pathways
sto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    STK_04520
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STK_04520
   00525 Acarbose and validamycin biosynthesis
    STK_04520
Enzymes [BR:sto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.157  glucosamine-1-phosphate N-acetyltransferase
     STK_04520
    2.3.1.276  galactosamine-1-phosphate N-acetyltransferase
     STK_04520
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     STK_04520
    2.7.7.24  glucose-1-phosphate thymidylyltransferase
     STK_04520
    2.7.7.83  UDP-N-acetylgalactosamine diphosphorylase
     STK_04520
SSDB
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 IspD DUF1565 CTP_transf_3 Fucokinase
Other DBs
NCBI-ProteinID: BAB65442
UniProt: Q975F9
Structure
PDB: 
2GGO 2GGQ 5Z0A 5Z09

Position
complement(456368..457573)
AA seq 401 aa
MKAFILAAGSGERLEPITHTRPKAFVPILSKPLIEYQIEYLRKCGIRDITVIVSSKNKEY
FEKKLKEISIVTQKDDIKGTGAAILSAKFNDEALIIYGDLFFSNEKEICNIITLKENAII
GVKVSNPKDYGVLVLDNQNNLSKIIEKPEIPPSNLINAGIYKLNSDIFTYLDKISISERG
ELELTDAINLMAKDHRVKVIEYEGYWMDIGKPWNIIDVNKWALDNLVFSQNLGNVEDNVK
IKGKVIIEEDAEIKSGTYIEGPVYIGKGSEIGPNSYLRPYTILVEKNKIGASVEVKESVI
MEGSKIPHLSYVGDSVIAEDVNFGAGTLIANLRFDEKEVKVNVKGKRISSGRRKLGAFIG
GHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFFKV
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaaggcatttattcttgctgcaggttctggtgaaagattagaaccaataacgcataca
aggcctaaagcttttgttccaattctctcaaagccgttaatcgagtaccagatagagtat
ttaagaaaatgtggaatcagagatataactgtaatagtttcttctaaaaataaagaatat
tttgagaaaaaacttaaagaaatatctatagttactcagaaagatgatataaaagggaca
ggtgcggccatattgtctgcaaagtttaacgatgaagcacttataatttatggagattta
ttcttttcaaacgagaaagaaatatgtaacataataactctaaaagaaaatgcaataata
ggtgttaaagttagtaatccaaaagattacggtgtacttgtattagacaatcagaataac
ttatctaaaattatagaaaaaccagagatacctccatcaaatcttataaacgctggtatt
tacaaactcaattctgatatttttacatatctagataaaatatctatctcggaaagagga
gaacttgaacttactgatgccataaaccttatggcaaaagatcatagagtaaaggtaata
gaatatgaaggatattggatggatataggaaaaccttggaacataattgatgtaaataaa
tgggctttagataatcttgtatttagtcaaaatcttggtaatgttgaagataacgtaaag
ataaaaggaaaagttatcattgaggaagacgcagaaattaagtctggaacttacatagaa
ggaccagtttatattggaaaaggaagcgaaattggaccaaattcctatttaagaccttat
actatactagttgagaaaaacaaaataggagcatcagttgaagtaaaagaaagtgtgatt
atggaaggatctaagattccgcaccttagctatgttggtgattctgtcattgcagaagat
gtaaattttggtgcaggcactttaatagctaacttaaggtttgacgaaaaagaagttaag
gttaatgtaaaaggaaaaagaataagtagtggaagaagaaaactaggggcatttattgga
gggcatgttagaactggaataaacgttaccatattgcctggcgtaaaaattggtgcttat
gctagaatatatcctggtgcggttgtaaacagagatgtcggctatggtgagtttttcaag
gtctag

DBGET integrated database retrieval system