KEGG   Sulfurisphaera tokodaii: STK_04670
Entry
STK_04670         CDS       T00062                                 
Name
(GenBank) mini-chromosome maintenance protein
  KO
K10726  replicative DNA helicase Mcm [EC:5.6.2.3]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    STK_04670
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sto03032]
    STK_04670
Enzymes [BR:sto01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     STK_04670
DNA replication proteins [BR:sto03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (archaeal)
    STK_04670
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid MCM_C MCM_N AAA_5 Mg_chelatase AAA_3 Sigma54_activat HTH_IclR DUF3987 Fe_dep_repress AAA_16 MarR_2
Other DBs
NCBI-ProteinID: BAK54294
UniProt: F9VMZ7
Position
complement(469878..471938)
AA seq 686 aa
MAIQQADYGDLLLEFINTYRDSKGKPTYLNQINEIIAYRKKSIIINFSDLFNFNEQLATQ
IINNPKEIFPILENKIYDYIIEKDPSFQEEIKKIHLRITNVPRLIELRKIRSSDAGKLIT
IEGILVKSTPVKERLSRSVFKHINPDCMQDFVWPPEGEFDEIIELPTTCPVCGKAGQFKL
IEDRSEFIDWQKAVIQERPEEIPPGQLPRQLEVVFEDDLVDSARPGDRVKIVGILEIKKD
SQIKRGSKAIFDFYLKVNSIEISQKVLDEVKISEEDEKKIRELSRDPWIREKIISSIAPS
IYGHWEIKEAIALALFGGVPKIMEDGTRVRGDIHVLIIGDPGTAKSQILQFAARVAPRAV
YTTGKGSTAAGLTATVTRDKNTGDYYLEAGALVLADGGVAVIDEIDKMREEDRVAIHEAM
EQQTVSIAKAGIVAKLNARATVVAAGNPKLGRYIAERGIAENINLPPTILSRFDLIFILI
DKPGVEDQLLASHILNVHAGKTKSTEIIDVDLLKKYIAYARKNVFPKLSDEAKSLLQDFF
VEMRKKSSESPDSPIIITPRQLEALIRISEAYARMALKNEVTREDAERAINIMRIFLENV
GLDVESGKIDIDTIMTGKPKSAREKMARILEIIDTLAGTNECAKVKEIVKEAEGIGIDKA
SVEKLLTDMRKQGLIYESRPDCYRKV
NT seq 2061 nt   +upstreamnt  +downstreamnt
ttggctatacaacaagctgactacggagacttgttacttgaatttatcaatacatataga
gatagcaaaggtaagcctacttatcttaatcaaataaatgaaattattgcatatagaaag
aagagcattataataaatttcagcgatttgtttaactttaatgagcaactagcgactcaa
ataatcaataatcctaaagaaatttttcctatattagagaataaaatatatgactatata
atagaaaaagatccttcattccaagaggaaataaagaaaatacacttaagaattactaat
gtaccaagactcatagaattaagaaaaataagaagtagtgatgcaggaaaactaattaca
atagaaggtatattagttaaatctactccagtaaaagaaagattgagcagatcagtgttt
aaacacattaatccagattgtatgcaagattttgtatggccaccagaaggagaatttgat
gaaattattgaactacctacaacatgtccggtgtgtggaaaagctggacaatttaaactt
attgaggacagatcagaattcatagattggcaaaaagcagtcattcaagagaggccagaa
gaaattccacctggacagttacctagacaacttgaagtagtctttgaagacgatttagtt
gattctgcccgtcctggagatagagtgaagatagttggaattttagagataaagaaagat
tctcaaataaaaagagggagcaaagctatctttgatttttatttgaaagttaatagtata
gaaatttcacaaaaagtattggatgaagtaaagatctcagaagaagatgagaaaaaaatt
agagaattatctagagatccttggataagagagaagataattagttcaatagcgccatca
atatacggacattgggagataaaggaagcaatagcattagccctatttgggggagtacca
aagataatggaagatggtaccagagtaagaggagatatacatgtactaattattggtgat
ccaggtacagcgaaatctcaaattttacagtttgctgcaagagttgctcctagagctgta
tatacaactggaaaaggttctactgctgctggattaacagctacggtaactagagataaa
aatactggagattattatttagaagctggtgcattagtattagcagatggaggagtcgca
gtaatagatgaaattgataaaatgagagaagaagatagagtagcaatacatgaagcaatg
gaacagcaaacagtctctatagcaaaagctggaattgttgctaagctaaatgcaagagct
acagtagtagctgcaggaaatcctaagttaggaagatatatagctgaaagaggaatagct
gaaaatattaatttaccacctactatactttcaagatttgatttgatatttatactaata
gataaacctggtgtagaagatcaattattagcttcacatatattaaatgttcatgctggt
aaaacaaagagtacagaaattatagatgtagatttacttaagaagtacatagcatatgca
aggaagaatgtatttccaaaactgagtgatgaagcaaagagtttattgcaagatttcttc
gtagagatgagaaagaagagttctgaatcaccagattctccaataattataaccccaaga
caacttgaagccttaataagaatatctgaagcttatgcaagaatggcactaaaaaatgaa
gttacgagagaagatgctgaaagagcaataaatataatgagaatattcctcgagaatgta
ggattagatgtagaatctggcaaaatagatattgatacgattatgactggaaagccaaag
agtgcaagagaaaaaatggccagaatactagaaatcatcgataccttagctggcacaaac
gagtgtgcaaaagtaaaagagattgtaaaagaagctgagggaataggaattgataaagca
agtgtagaaaaattattaaccgatatgagaaaacaaggcttaatttacgaatctagacca
gattgttatagaaaagtctaa

DBGET integrated database retrieval system