KEGG   Sulfurisphaera tokodaii: STK_04720
Entry
STK_04720         CDS       T00062                                 
Symbol
moaC
Name
(GenBank) molybdenum cofactor biosynthesis protein MoaC
  KO
K03637  cyclic pyranopterin monophosphate synthase [EC:4.6.1.17]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00790  Folate biosynthesis
sto01100  Metabolic pathways
sto01240  Biosynthesis of cofactors
sto04122  Sulfur relay system
Module
sto_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STK_04720 (moaC)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    STK_04720 (moaC)
Enzymes [BR:sto01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.17  cyclic pyranopterin monophosphate synthase
     STK_04720 (moaC)
SSDB
Motif
Pfam: MoaC TIP49 DUF2976
Other DBs
NCBI-ProteinID: BAB65466
UniProt: Q975D5
Structure
Position
474544..474999
AA seq 151 aa
MTEAKIVDISSKDIVLREAVVEGYIKLRKETIEKIKNKEVEKGDVITVAKTAGILAAKKT
PELIPMCHPIPLEFVDVEIKIEEEGLRVISTVKAHYKTGVEMEALTATSVALLTIWDMVK
KYEKDENGQYPYTEIKSIRVINKIKTYDDMK
NT seq 456 nt   +upstreamnt  +downstreamnt
atgactgaagcaaaaatagtagatatttcatctaaggatatagttctaagggaagctgtg
gtagaaggttatataaaattaagaaaagaaacaatagaaaaaattaaaaataaagaagtt
gaaaaaggcgatgtaattactgtagctaaaacagctggaatattagctgctaaaaaaact
ccagaattaataccaatgtgtcacccaatacctttagagtttgttgatgtagaaattaaa
attgaagaagaaggattaagagtaataagtactgttaaggctcattataagactggtgtt
gaaatggaagcactaaccgcaacttcagtggctcttcttactatttgggacatggttaaa
aagtatgaaaaagatgaaaatggacagtatccttatactgagataaagtcaattagggtt
attaataaaattaagacttacgacgatatgaagtag

DBGET integrated database retrieval system