KEGG   Sulfurisphaera tokodaii: STK_04790
Entry
STK_04790         CDS       T00062                                 
Name
(GenBank) hypothetical protein
Organism
sto  Sulfurisphaera tokodaii
SSDB
Motif
Pfam: DUF2400
Other DBs
NCBI-ProteinID: BAB65472
UniProt: Q975C9
Position
complement(479664..480095)
AA seq 143 aa
MYLKNPPRIKVLEALGAIADGRVKVINENECEVISSEGDRIYKVIIKGDLVNSNDNGTVY
RNYVGYPIIACLMLLKKLSFNEKFSSALKGIPWRKLNEEYKSYERVEEIVFNIAKERNVN
RWELENFIKVILDELRRLHLRKT
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtatttaaaaaatcctccacgaataaaagtacttgaagctttaggtgctatagctgat
ggtagagttaaagttattaacgagaatgaatgtgaagtaatttcctcagaaggtgataga
atttataaagttattatcaaaggagatctcgttaatagtaatgataatggtactgtttat
cgaaattacgtgggatatcctataatagcttgtttaatgttgttgaaaaaactatctttt
aatgagaagttttctagtgcattaaaaggaataccttggaggaaactaaatgaagagtat
aaaagttatgaaagagttgaggaaatagtctttaatattgctaaagaaagaaacgttaat
aggtgggaattggaaaattttataaaggtaatccttgatgaacttagaagattacatctt
agaaagacttaa

DBGET integrated database retrieval system