KEGG   Sulfurisphaera tokodaii: STK_04830
Entry
STK_04830         CDS       T00062                                 
Symbol
arf1
Name
(GenBank) translation termination factor aRF1
  KO
K03265  peptide chain release factor subunit 1
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sto03019]
    STK_04830 (arf1)
   03012 Translation factors [BR:sto03012]
    STK_04830 (arf1)
Messenger RNA biogenesis [BR:sto03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     STK_04830 (arf1)
Translation factors [BR:sto03012]
 Eukaryotic type
  Release factors
   STK_04830 (arf1)
SSDB
Motif
Pfam: eRF1_2 eRF1_3 eRF1_1 acVLRF1 baeRF_family10 DUF1843
Other DBs
NCBI-ProteinID: BAK54298
UniProt: F9VN01
Position
482829..483878
AA seq 349 aa
MKKWSAPATVLLSLYIPPGRPIPDVLNLLRQEYSIAQNIKLKRTRDAVTSAIQSAIDRLT
QIPKVPDNGLVIFCGENFETEESKCFVFSPPEKVTIFFYRTDKYFHTEFLEDMIEENDVF
GLIIVERDYATIGILKGTRIEVLDEFEGFVPGKHMMGGQSQRRIDRIIEEMYANFLKEVG
EKANSYLLPYLESGKLKGILLGGPGYAKKDFYDGDYLDYRLKKLVLLPLIDIPDQGDAGL
KELVMKAQDILKNQKYVQVQNLLEELKYHIAKDDGLVVYGIEEIRKALHMGAVDSLVIYD
EPNSELEKLSQEAENYGTKVYVVGDELPDAEWVKKTFGGAIGKLRYKIY
NT seq 1050 nt   +upstreamnt  +downstreamnt
ttgaaaaaatggtctgccccagctacagtgttgctatcattgtacataccacctggaaga
cctataccagatgttctcaatttattaaggcaagaatattcaatagcgcaaaatattaaa
ttgaagagaactagggatgcagtaacttcggcaatccaatcagctatagatagactaacg
caaatacctaaggttccagataacggattagttatattctgtggtgagaatttcgagaca
gaagaatcaaaatgttttgtgttctctccaccggaaaaagttacaatattcttttacaga
acagacaaatattttcatactgaatttctagaagatatgatagaagaaaatgacgttttc
ggattaataatagttgaaagagattatgctacaattggtatattaaaaggaaccagaata
gaagtgcttgacgagtttgaaggctttgtaccgggtaagcatatgatgggtggacagtct
caaagacgtattgatagaataattgaggaaatgtatgctaatttcttgaaagaagtagga
gaaaaggcaaattcatatttacttccttatttagagagcgggaaattaaagggaatatta
ttaggaggaccaggatatgcaaagaaagatttctacgatggagattatttagattatagg
ctaaaaaaattggttctattaccccttattgatattccggaccaaggtgatgctggatta
aaggagttagttatgaaggcacaagatattttgaaaaaccagaaatatgtccaagttcaa
aatctcctagaagaactaaaatatcatatcgctaaggatgacggcctagtagtttatggt
attgaagaaataagaaaagcgttacatatgggtgctgtcgattcattagttatctatgat
gagccaaatagtgaattagagaaactttcacaagaagcagaaaattatggtacaaaagtt
tatgtagtaggggatgaattgccagatgctgaatgggtcaaaaagacatttggtggagct
ataggtaaattaagatataaaatatactaa

DBGET integrated database retrieval system