KEGG   Sulfurisphaera tokodaii: STK_04870
Entry
STK_04870         CDS       T00062                                 
Name
(GenBank) hexaprenyl diphosphate synthase
  KO
K21268  hexaprenyl diphosphate synthase [EC:2.5.1.82]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00900  Terpenoid backbone biosynthesis
sto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STK_04870
Enzymes [BR:sto01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.82  hexaprenyl diphosphate synthase [geranylgeranyl-diphosphate specific]
     STK_04870
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-ProteinID: BAB65480
UniProt: Q975C1
Position
486170..487021
AA seq 283 aa
MDLLSYWKKSKEIIDKLVDDYLVDIKDWQLLEVSKYILKDGKRFRGTLTFLFTEALNGDI
KNAYKAALASEILHSASLALDDIVDYDIIRRGGSSAWAIYTNRKVIFITNYLIPSALNII
STYGEEALKISIQLWKDTAVGALKDIFGSPSEYLSTIELKTSSLFKLSTMLASFASHRED
LVEETLDIGKYIGIAYQLVDDYIDCVKYERGELKELTGSAKQLYELKGKEYKEFVKKQYE
NALTNYLDIVRKLEISQDFTEAIISLPTFLTKGLLNEAGLDKL
NT seq 852 nt   +upstreamnt  +downstreamnt
gtggatttactttcttattggaaaaagagcaaggagatcattgataaattagttgacgat
tatttagttgatattaaagattggcaattattagaagttagtaaatatatactaaaggat
gggaagagatttagggggacattaacatttttatttacagaagctcttaatggggatata
aaaaatgcatataaagcagctcttgcttcagagattcttcattccgcatctcttgcattg
gatgatattgtagattatgatataattagaagaggagggagttcagcttgggcaatttat
actaacaggaaagttatctttattaccaattatctaattccctcagcattaaatataatc
tctacttacggagaagaggcgttaaaaattagtatacaactgtggaaggatacggctgta
ggtgctttaaaggatatatttggttctccttcagaatatctttctacgatcgaactaaaa
acctctagtttatttaaactatctacgatgttagcctcatttgcatctcatagagaagat
ttagtggaagaaactttagatatagggaaatatataggaatcgcctatcaattagttgat
gattatatagattgtgtaaaatatgaaagaggagaattaaaggagctaactggaagtgct
aaacagttatatgaacttaaagggaaagagtataaagagtttgtaaagaagcaatatgaa
aatgctttaactaattacttagatattgtaagaaaattggaaataagtcaagattttact
gaagctataatatcgttgccaacttttttaacgaaggggcttttaaacgaagccgggctg
gataaattataa

DBGET integrated database retrieval system